MilliporeSigma
All Photos(1)

Documents

SAB2100035

Sigma-Aldrich

Anti-ACSL4 antibody produced in rabbit

affinity isolated antibody

Sign Into View Organizational & Contract Pricing

Synonym(s):
Anti-ACS4, Anti-Acyl-CoA synthetase long-chain family member 4, Anti-FACL4, Anti-LACS4, Anti-MRX63, Anti-MRX68
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

74 kDa

species reactivity

rat, rabbit, guinea pig, mouse, bovine, human, dog, horse

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ACSL4(2182)

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item
HPA040470HPA011315HPA007162
conjugate

unconjugated

conjugate

-

conjugate

unconjugated

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody form

affinity isolated antibody

antibody form

affinity isolated antibody

antibody form

affinity isolated antibody

clone

polyclonal

clone

polyclonal

clone

polyclonal

clone

polyclonal

form

buffered aqueous solution

form

buffered aqueous glycerol solution

form

buffered aqueous glycerol solution

form

buffered aqueous glycerol solution

mol wt

74 kDa

mol wt

-

mol wt

-

mol wt

-

Still not finding the right product?  

Give our Product Selector Tool a try.

General description

Acyl-CoA synthetase long-chain family member 4 (Acsl4) is encoded by the gene mapped to human chromosome Xq22.3−Xq23. Acsl4 is a member of the long-chain fatty-acid-coenzyme A ligase family. All the members of this family have different substrate specificity, subcellular localization, and tissue distribution. Alternative splicing of Acsl4 gene generates two transcript variants.

Immunogen

Synthetic peptide directed towards the N terminal region of human ACSL4

Application

Anti-ACSL4 antibody produced in rabbit has been used as a mitochondria-associated membrane (MAM) marker.

Biochem/physiol Actions

ACSL4 is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme preferentially utilizes arachidonate as substrate. The absence of this enzyme may contribute to the mental retardation or Alport syndrome. Alternative splicing of this gene generates two transcript variants.
Long-chain fatty-acid-coenzyme A ligase family members convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby facilitate lipid biosynthesis and fatty acid degradation. Acsl4 plays a critical role in ferroptosis execution. It also contributes to the dendritic spine architecture. Acsl4 isozyme preferentially utilizes arachidonate as substrate. The absence of this enzyme may contribute to the non-syndromic X-linked mental retardation or Alport syndrome.

Sequence

Synthetic peptide located within the following region: AKRIKAKPTSDKPGSPYRSVTHFDSLAVIDIPGADTLDKLFDHAVSKFGK

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Documents related to the products that you have purchased in the past have been gathered in the Document Library for your convenience.

Visit the Document Library

Difficulty Finding Your Product Or Lot/Batch Number?

Product numbers are combined with Pack Sizes/Quantity when displayed on the website (example: T1503-25G). Please make sure you enter ONLY the product number in the Product Number field (example: T1503).

Example:

T1503
Product Number
-
25G
Pack Size/Quantity

Additional examples:

705578-5MG-PW

PL860-CGA/SHF-1EA

MMYOMAG-74K-13

1000309185

enter as 1.000309185)

Having trouble? Feel free to contact Technical Service for assistance.

Lot and Batch Numbers can be found on a product's label following the words 'Lot' or 'Batch'.

Aldrich Products

  • For a lot number such as TO09019TO, enter it as 09019TO (without the first two letters 'TO').

  • For a lot number with a filling-code such as 05427ES-021, enter it as 05427ES (without the filling-code '-021').

  • For a lot number with a filling-code such as STBB0728K9, enter it as STBB0728 without the filling-code 'K9'.

Not Finding What You Are Looking For?

In some cases, a COA may not be available online. If your search was unable to find the COA you can request one.

Request COA

N-Acetylcysteine prevents the spatial memory deficits and the redox-dependent RyR2 decrease displayed by an Alzheimer?s disease rat model
More JY, et al.
Frontiers in Aging Neuroscience, 10(4), 399-399 (2018)
AMMECR1: a single point mutation causes developmental delay, midface hypoplasia and elliptocytosis
Andreoletti G, et al.
Journal of medical Genetics, 54(4), 269-277 (2017)
The XLMR gene ACSL4 plays a role in dendritic spine architecture
Meloni I, et al.
Neuroscience, 159, 657-669 (2009)
Acsl4 Dictates Ferroptosis Sensitivity by Shaping Cellular Lipid Composition
Doll S, et al.
Nature Chemical Biology, 13, 91-91 (2017)
Jamileth More et al.
Frontiers in aging neuroscience, 10, 399-399 (2018-12-24)
We have previously reported that primary hippocampal neurons exposed to synaptotoxic amyloid beta oligomers (AβOs), which are likely causative agents of Alzheimer's disease (AD), exhibit abnormal Ca2+ signals, mitochondrial dysfunction and defective structural plasticity. Additionally, AβOs-exposed neurons exhibit a decrease

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service