MilliporeSigma
All Photos(4)

Documents

SAB2100200

Sigma-Aldrich

Anti-BACE1 antibody produced in rabbit

affinity isolated antibody

Sign Into View Organizational & Contract Pricing

Synonym(s):
Anti-β-Site APP-cleaving enzyme 1, Anti-ASP2, Anti-BACE, Anti-FLJ90568, Anti-HSPC104
MDL number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

51 kDa

species reactivity

rabbit, bovine, guinea pig, mouse, rat, horse, dog, human

concentration

0.5 mg - 1 mg/mL

technique(s)

immunofluorescence: suitable
immunohistochemistry: suitable
western blot: suitable

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... BACE1(23621)

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item
B1310SAB4301112SAB3500240
antibody form

affinity isolated antibody

antibody form

affinity isolated antibody

antibody form

affinity isolated antibody

antibody form

IgG fraction of antiserum

conjugate

unconjugated

conjugate

unconjugated

conjugate

-

conjugate

unconjugated

biological source

rabbit

biological source

rabbit

biological source

rabbit

biological source

rabbit

concentration

0.5 mg - 1 mg/mL

concentration

-

concentration

0.3 mg/mL

concentration

-

UniProt accession no.

P56817

UniProt accession no.

Q9BX63

UniProt accession no.

P12821

UniProt accession no.

P56817

Still not finding the right product?  

Give our Product Selector Tool a try.

General description

β-site APP cleaving enzyme (BACE-1) is known as β-secretase. It consists of an N-terminal signal peptide (SP), a pro-peptide (Pro) domain, a catalytic domain, a transmembrane domain and a C-terminal tail.
BACE1, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease that is found mainly in the Golgi.

Immunogen

Synthetic peptide directed towards the N terminal region of human BACE1

Biochem/physiol Actions

β-site APP cleaving enzyme (BACE-1) acts as a rate-limiting enzyme of amyloid-β-peptide (Aβ). Overexpression of BACE-1 leads to increased β-secretase activity.

Sequence

Synthetic peptide located within the following region: GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Documents related to the products that you have purchased in the past have been gathered in the Document Library for your convenience.

Visit the Document Library

Difficulty Finding Your Product Or Lot/Batch Number?

Product numbers are combined with Pack Sizes/Quantity when displayed on the website (example: T1503-25G). Please make sure you enter ONLY the product number in the Product Number field (example: T1503).

Example:

T1503
Product Number
-
25G
Pack Size/Quantity

Additional examples:

705578-5MG-PW

PL860-CGA/SHF-1EA

MMYOMAG-74K-13

1000309185

enter as 1.000309185)

Having trouble? Feel free to contact Technical Service for assistance.

Lot and Batch Numbers can be found on a product's label following the words 'Lot' or 'Batch'.

Aldrich Products

  • For a lot number such as TO09019TO, enter it as 09019TO (without the first two letters 'TO').

  • For a lot number with a filling-code such as 05427ES-021, enter it as 05427ES (without the filling-code '-021').

  • For a lot number with a filling-code such as STBB0728K9, enter it as STBB0728 without the filling-code 'K9'.

Not Finding What You Are Looking For?

In some cases, a COA may not be available online. If your search was unable to find the COA you can request one.

Request COA

Proteolytic processing of Neuregulin-1
Willem M
Brain Research Bulletin, 126(5), 178-182 (2016)
pHluorin-BACE1-mCherry Acts as a Reporter for the Intracellular Distribution of Active BACE1 In Vitro and In Vivo
Zhao L, et al.
Cells, 8(5), 474-474 (2019)
beta-Site APP cleaving enzyme up-regulation induced by 4-hydroxynonenal is mediated by stress-activated protein kinases pathways
Tamagno E, et al.
Journal of Neurochemistry, 92(3), 628-636 (2005)
Chang Qu et al.
Journal of advanced research, 35, 231-243 (2022-01-14)
Honokiol (HO) exerts neuroprotective effects in several animal models of Alzheimer's disease (AD), but the poor dissolution hampers its bioavailability and therapeutic efficacy. A novel honokiol nanoscale drug delivery system (Nano-HO) with smaller size and excellent stability was developed in
Edward T Parkin et al.
PloS one, 17(1), e0255715-e0255715 (2022-01-14)
The amyloid cascade hypothesis proposes that excessive accumulation of amyloid beta-peptides is the initiating event in Alzheimer's disease. These neurotoxic peptides are generated from the amyloid precursor protein via sequential cleavage by β- and γ-secretases in the 'amyloidogenic' proteolytic pathway.

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service