SAB2100731

Sigma-Aldrich

Anti-EXOSC2 antibody produced in rabbit

affinity isolated antibody

Synonym(s):
Anti-HRrp4p, Anti-P7, Anti-Exosome component 2, Anti-RRP4
NACRES:
NA.41

biological source

rabbit

Quality Level

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

32 kDa

species reactivity

guinea pig, mouse, rabbit, dog, bovine, rat, human, horse

concentration

0.5 mg - 1 mg/mL

application(s)

western blot: suitable

conjugate

unconjugated

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... EXOSC2(23404)

Immunogen

Synthetic peptide directed towards the middle region of human EXOSC2

Application

Anti-EXOSC2 antibody produced in rabbit is suitable for western blot applications.

Biochem/physiol Actions

EXOSC2 belongs to the exosome, a RNA-processing complex, which is at least involved in the 3′ processing of the 7S pre-rRNA to the mature 5.8S rRNA. It exhibits a 3′-5′ exoribonuclease activity.

Sequence

Synthetic peptide located within the following region: AEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCG

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

storage_class_code

12 - Non Combustible Liquids

WGK Germany

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis

Certificate of Origin

Daniel L Kiss et al.
RNA (New York, N.Y.), 16(4), 781-791 (2010-02-27)
The RNA processing exosome complex was originally defined as an evolutionarily conserved multisubunit complex of ribonucleases responsible for the processing and/or turnover of stable RNAs. The exosome complex is also involved in the surveillance of mRNAs in both the nucleus...
Rafal Tomecki et al.
The EMBO journal, 29(14), 2342-2357 (2010-06-10)
The eukaryotic RNA exosome is a ribonucleolytic complex involved in RNA processing and turnover. It consists of a nine-subunit catalytically inert core that serves a structural function and participates in substrate recognition. Best defined in Saccharomyces cerevisiae, enzymatic activity comes...

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service