All Photos(1)



Anti-KLF9 (ab1) antibody produced in rabbit

affinity isolated antibody

Anti-BTEB1, Anti-Kruppel-like factor 9, Anti-BTEB

biological source




antibody form

affinity isolated antibody

antibody product type

primary antibodies




buffered aqueous solution

mol wt

27 kDa

species reactivity

mouse, guinea pig, rat, horse, rabbit, bovine, human


0.5 mg - 1 mg/mL


immunohistochemistry: suitable
western blot: suitable

UniProt accession no.

shipped in

wet ice

storage temp.


Gene Information

human ... KLF9(687)


The immunogen for anti-KLF9 antibody: synthetic peptide derected towards the N terminal of human KLF9


Synthetic peptide located within the following region: LPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSDSLE

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.


Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Certificate of Analysis

Certificate of Origin

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service