All Photos(2)

SAB2101297

Sigma-Aldrich

Anti-KRAS antibody produced in rabbit

affinity isolated antibody

Synonym(s):
Anti-K-RAS2A, Anti-K-RAS4A, Anti-C-K-RAS, Anti-K-RAS2B, Anti-V-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog
MDL number:

biological source

rabbit

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

lyophilized powder

mol wt

22 kDa

species reactivity

rat, horse, human, mouse, rabbit, guinea pig

concentration

0.5 mg - 1 mg/mL

application(s)

western blot: suitable

conjugate

unconjugated

UniProt accession no.

storage temp.

−20°C

Gene Information

human ... KRAS(3845)

Immunogen

The immunogen for anti-KRAS antibody: synthetic peptide derected towards the N terminal of human KRAS

Sequence

Synthetic peptide located within the following region: TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETC

Physical form

Lyophilized from PBS buffer with 2% sucrose

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Certificate of Analysis

Certificate of Origin

Wulamujiang Aini et al.
Transplant immunology, 31(2), 55-59 (2014-07-06)
In living donor liver transplantation, the biological organ age of the donated allograft is unknown in young patients who receive grafts from older donors. Few studies have focused on the effects of aging on allografts in the state of tolerance....
Joseph Carver et al.
PloS one, 9(8), e103836-e103836 (2014-08-06)
Mutations in the Ras family of small GTPases, particularly KRAS, occur at high frequencies in cancer and represent a major unmet therapeutic need due to the lack of effective targeted therapies. Past efforts directed at inhibiting the activity of the...
Hua Yang et al.
Anti-cancer drugs, 25(7), 767-777 (2014-04-02)
Histone deacetylase inhibitors are a new class of anticancer agents that inhibit cancer cell proliferation and induce apoptosis and cell cycle arrest in various cancer cells. Recently, we identified ZYJ-34c, a modified histone deacetylase inhibitor that showed significantly higher antitumor...
Maria Angelica Cortez et al.
Molecular therapy : the journal of the American Society of Gene Therapy, 22(8), 1494-1503 (2014-05-06)
The microRNA (miR)-200s and their negative regulator ZEB1 have been extensively studied in the context of the epithelial-mesenchymal transition. Loss of miR-200s has been shown to enhance cancer aggressiveness and metastasis, whereas replacement of miR-200 miRNAs has been shown to...
Ki Hwan Kweon et al.
International journal of oncology, 45(5), 2065-2075 (2014-08-12)
Despite the favorable therapeutic outcomes reported in differentiated thyroid cancer (DTC), a significant proportion of DTC patients present with refractory behavior to conventional therapy. The sirtuin (Sirt) family has recently been implicated in the maintenance of cellular homeostasis under genotoxic...

Articles

Oncogenes and Tumor Suppressors Reprogram Metabolism

We present an article about how proliferating cells require the biosynthesis of structural components for biomass production and for genomic replication.

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service