SAB2106435

Sigma-Aldrich

Anti-KLF4 antibody produced in rabbit

affinity isolated antibody

NACRES:
NA.41

biological source

rabbit

Quality Level

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

51 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

application(s)

western blot: suitable

conjugate

unconjugated

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... Klf4(16600)

Immunogen

Synthetic peptide directed towards the N terminal of human KLF4

Sequence

Synthetic peptide located within the following region: MRQPPGESDMAVSDALLPSFSTFASGPAGREKTLRPAGAPTNRWREELSH

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

storage_class_code

12 - Non Combustible Liquids

WGK Germany

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis

Certificate of Origin

Ming-Quan Ma et al.
International journal of clinical and experimental pathology, 7(10), 6679-6685 (2014-11-18)
To investigate the association of Kruppel-like factor 4 (KLF4) expressions with the prognosis of esophageal squamous cell carcinoma (SCC) patients. Ninety-eight cases of esophageal carcinoma patients were enrolled. The expression of KLF4 in the esophageal SCC and normal esophageal mucosa...
Hsiao-Fan Chen et al.
Nature communications, 5, 4697-4697 (2014-08-26)
The mechanisms controlling tumour-induced angiogenesis are presently not clear. In principle, angiogenesis can be achieved through the activation of endothelial cells in existing vessels or by transdifferentiation of tumour cells into endothelial cells. However, whether tumour cells can go through...

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service