SAB2106775

Anti-ST6GALNAC1 antibody produced in rabbit

affinity isolated antibody

• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 61 kDa
• species reactivity: dog, bovine, human, rat, rabbit, guinea pig, horse
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NM_011371
• UniProt accession no.: Q9QZ39
• shipped in: wet ice
• storage temp.: −20°C
• Gene Information: human ... ST6GALNAC1(55808)

Description

Immunogen

The immunogen for anti-ST6GALNAC1 antibody: synthetic peptide derected towards the C terminal of human ST6GALNAC1

Biochem/physiol Actions

St6galnac1 transfers CMP-NeuAc with an alpha-2,6-linkage to the GalNAc residues of GalNAc-O-Ser/Thr, Gal-beta-1,3-GalNAc-O-Ser/Thr and NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc-O-Ser/Thr are substrates. Higher activity towards GalNAc-O-Ser/Thr.

Sequence

Synthetic peptide located within the following region: GALLLLTALHLCDKVSAYGFITEGHQRFSDHYYDTSWKRLIFYINHDFRL

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 12 - Non Combustible Liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable