SAB2108245

Anti-TRPC4 antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-HTRP-4, Anti-HTRP4, Anti-TRP4
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: IHC
• Species reactivity: mouse, rabbit, human
• Citations: 2
• Technique(s): immunoblotting: suitable, immunohistochemistry: suitable
• Uniprot accession no.: Q9UBN4

Properties

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 112kDa
• species reactivity: mouse, rabbit, human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunoblotting: suitable, immunohistochemistry: suitable
• NCBI accession no.: NM_016179
• UniProt accession no.: Q9UBN4
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Quality Level: 100
• Gene Information: human ... TRPC4(7223)

Description

Biochem/physiol Actions

TRPC4 is thought to form a receptor-activated non-selective calcium permeant cation channel. TRPC4 probably is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. It has also been shown to be calcium-selective. TRPC4 may also be activated by intracellular calcium store depletion.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human TRPC4

Other Notes

Synthetic peptide located within the following region: CPFKSEKVVVEDTVPIIPKEKHAKEEDSSIDYDLNLPDTVTHEDYVTTRL

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable