SAB2108477

Sigma-Aldrich

Anti-FOXP3

IgG fraction of antiserum

Synonym(s):
Anti- IPEX, Anti- XPID, Anti- AIID, Anti- PIDX, Anti-JM2
NACRES:
NA.41

biological source

rabbit

Quality Level

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

47 kDa

species reactivity

pig, human, sheep, bovine

concentration

0.5-1 mg/mL

application(s)

immunoblotting: suitable
immunohistochemistry: suitable

conjugate

unconjugated

accession no.

NM_014009

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... FOXP3(50943)

Immunogen

Synthetic peptide directed towards the N terminal region of human FOXP3

Biochem/physiol Actions

Forkhead box protein P3 (FOXP3, Scurfin, Zinc finger protein JM2) encodes a novel member of the forkhead family of transcription factors. It presumably represses transcription, playing a paramount role in determining the amplitude of the response of CD4 T cells to activation

Sequence

Synthetic peptide located within the following region: PHFMHQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGVFSLKARPGL

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

storage_class_code

12 - Non Combustible Liquids

WGK Germany

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis

Certificate of Origin

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service