MilliporeSigma
All Photos(3)

Documents

SAB2108511

Sigma-Aldrich

Anti-GPC3

IgG fraction of antiserum

Sign Into View Organizational & Contract Pricing

Select a Size

Synonym(s):
Anti- DGSX, Anti- MXR7, Anti- SDYS, Anti- SGBS, Anti-SGB
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

64 kDa

species reactivity

mouse, horse, dog, rabbit, bovine, guinea pig, rat, human

concentration

0.5-1 mg/mL

technique(s)

immunoblotting: suitable
immunohistochemistry: suitable

accession no.

NM_004484

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... GPC3(2719)

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item
AMAB91803MABC667SAB2108510
Anti-GPC3 IgG fraction of antiserum

Sigma-Aldrich

SAB2108511

Anti-GPC3

Anti-TGFB1 IgG fraction of antiserum

Sigma-Aldrich

SAB2108510

Anti-TGFB1

conjugate

unconjugated

conjugate

unconjugated

conjugate

-

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody form

-

antibody form

ascites fluid

antibody form

IgG fraction of antiserum

clone

polyclonal

clone

CL12711, monoclonal

clone

9C2, monoclonal

clone

polyclonal

form

buffered aqueous solution

form

buffered aqueous glycerol solution

form

-

form

buffered aqueous solution

mol wt

64 kDa

mol wt

-

mol wt

-

mol wt

42 kDa

Immunogen

Synthetic peptide directed towards the middle region of human GPC3

Biochem/physiol Actions

Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. Deletion mutations in this gene are associated with Simpson-Golabi-Behmel syndrome.

Sequence

Synthetic peptide located within the following region: FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVL

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Documents related to the products that you have purchased in the past have been gathered in the Document Library for your convenience.

Visit the Document Library

Difficulty Finding Your Product Or Lot/Batch Number?

Product numbers are combined with Pack Sizes/Quantity when displayed on the website (example: T1503-25G). Please make sure you enter ONLY the product number in the Product Number field (example: T1503).

Example:

T1503
Product Number
-
25G
Pack Size/Quantity

Additional examples:

705578-5MG-PW

PL860-CGA/SHF-1EA

MMYOMAG-74K-13

1000309185

enter as 1.000309185)

Having trouble? Feel free to contact Technical Service for assistance.

Lot and Batch Numbers can be found on a product's label following the words 'Lot' or 'Batch'.

Aldrich Products

  • For a lot number such as TO09019TO, enter it as 09019TO (without the first two letters 'TO').

  • For a lot number with a filling-code such as 05427ES-021, enter it as 05427ES (without the filling-code '-021').

  • For a lot number with a filling-code such as STBB0728K9, enter it as STBB0728 without the filling-code 'K9'.

Not Finding What You Are Looking For?

In some cases, a COA may not be available online. If your search was unable to find the COA you can request one.

Request COA

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service