


IgG fraction of antiserum

Anti-A4, Anti- A4LSB, Anti- A4-LSB, Anti- MGC126187

biological source


Quality Level

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies




buffered aqueous solution

mol wt

17 kDa

species reactivity

pig, dog, bovine, sheep, human


0.5-1 mg/mL


immunoblotting: suitable



accession no.


UniProt accession no.

shipped in

wet ice

storage temp.


Gene Information

human ... PLP2(5355)


Synthetic peptide directed towards the middle region of human PLP2

Biochem/physiol Actions

PLP2 may play a role in cell differentiation in the intestinal epithelium.


Synthetic peptide located within the following region: LVERGNHSKIVAGVLGLIATCLFGYDAYVTFPVRQPRHTAAPTDPADGPV

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.


Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.


NONH for all modes of transport

WGK Germany


Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis

Certificate of Origin

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service

Social Media

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon


Research. Development. Production.

We are a leading supplier to the global Life Science industry with solutions and services for research, biotechnology development and production, and pharmaceutical drug therapy development and production.

© 2021 Merck KGaA, Darmstadt, Germany and/or its affiliates. All Rights Reserved.

Reproduction of any materials from the site is strictly forbidden without permission.