SAB2108891

Anti-MED19 antibody produced in rabbit biotin conjugated

affinity isolated antibody

• Synonym(s): MTCYB
• NACRES: NA.45
• UNSPSC Code: 12352203
• Conjugate: biotin conjugate
• Clone: polyclonal
• Application: —

Properties

• biological source: rabbit
• conjugate: biotin conjugate
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 26 kDa
• species reactivity (predicted by homology): mouse, rat, horse, bovine, guinea pig, rabbit, human, canine
• concentration: 0.5 mg/mL
• NCBI accession no.: NM_153450
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... MED19(219541)

Description

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

MED19 is a component of the Mediator complex, which is a coactivator for DNA-binding factors that activate transcription via RNA polymerase II .

Immunogen

Synthetic peptide directed towards the middle region of Human MED19

Other Notes

Synthetic peptide located within the following region: LPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMH

Physical form

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk: nwg
• flash_point_f: Not applicable
• flash_point_c: Not applicable