SAB2109169

Anti-ROR1 (N-terminal) antibody produced in rabbit

affinity isolated antibody

• Synonym(s): MGC99659, NTRKR1, dJ537F10.1
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 104 kDa
• species reactivity (predicted by homology): guinea pig, horse, mouse, human, rabbit, rat, canine
• concentration: 0.5 mg/mL
• technique(s): western blot: 1 μg/mL
• NCBI accession no.: NM_005012
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ROR1(57396)

Description

General description

The protein encoded by this gene is a receptor protein tyrosine kinase that modulates neurite growth in the central nervous system. It is a type I membrane protein and belongs to the ROR subfamily of cell surface receptors. Alternative splicing results in multiple transcript variants encoding different isoforms.

Sequence

Synthetic peptide located within the following region: TASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITA

Physical form

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: nwg
• flash_point_f: Not applicable
• flash_point_c: Not applicable