WH0000332M1

Monoclonal Anti-BIRC5 antibody produced in mouse

clone 5B10, purified immunoglobulin, buffered aqueous solution

• Synonym(s): Anti-API4, Anti-EPR1, Anti-baculoviral IAP repeat-containing 5 (survivin)
• MDL number: MFCD02686632
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 5B10, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): immunofluorescence: suitable; immunoprecipitation (IP): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• GenBank® accession no.: NM_001168
• UniProt accession no.: O15392
• shipped in: dry ice
• storage temp.: −20°C
• Gene Information: human ... BIRC5(332)

Description

General description

This gene is a member of the inhibitor of apoptosis (IAP) gene family, which encode negative regulatory proteins that prevent apoptotic cell death. IAP family members usually contain multiple baculovirus IAP repeat (BIR) domains, but this gene encodes proteins with only a single BIR domain. The encoded proteins also lack a C-terminus RING finger domain. Gene expression is high during fetal development and in most tumors yet low in adult tissues. Antisense transcripts are involved in the regulation of this gene′s expression. At least four transcript variants encoding distinct isoforms have been found for this gene, but the full-length natures of only three of them have been determined. (provided by RefSeq)

Immunogen

BIRC5 (NP_001159, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGE

Packaging

100 μg

Biochem/physiol Actions

BIRC5 (Baculoviral inhibitor of apoptosis repeat-containing 5) functions as a cell surface receptor for factor Xa. It is predicted to be a potential factor in protease-dependent cellular effector functions. It also behaves as a receptor for factor Xa during the cell surface assembly of proteolytic activities and leukocyte mitogenesis. A study reports that the expression of BIRC5 can be controlled by mRNA splicing. It is an inhibitor of apoptosis and is expressed in various malignancies.

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 12 - Non Combustible Liquids
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable
• Personal Protective Equipment: dust mask type N95 (US), Eyeshields, Gloves