Documents
WH0000924M4
Monoclonal Anti-CD7 antibody produced in mouse
clone 1B8, purified immunoglobulin, buffered aqueous solution
Recommended Products
biological source
mouse
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
1B8, monoclonal
form
buffered aqueous solution
species reactivity
human
technique(s)
immunoprecipitation (IP): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL
isotype
IgG2bκ
GenBank® accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
Gene Information
human ... CD7(924)
1 of 4
This Item | SAB1404801 | SAB1402143 | WH0000965M1 |
|---|---|---|---|
| conjugate unconjugated | conjugate unconjugated | conjugate unconjugated | conjugate unconjugated |
| antibody form purified immunoglobulin | antibody form purified immunoglobulin | antibody form purified immunoglobulin | antibody form purified immunoglobulin |
| clone 1B8, monoclonal | clone 1C8, monoclonal | clone 4A2, monoclonal | clone 2D11-B10, monoclonal |
| form buffered aqueous solution | form buffered aqueous solution | form buffered aqueous solution | form buffered aqueous solution |
| species reactivity human | species reactivity human | species reactivity human | species reactivity human |
General description
Immunogen
Sequence
PGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ
Physical form
Legal Information
Storage Class Code
10 - Combustible liquids
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Personal Protective Equipment
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Documents related to the products that you have purchased in the past have been gathered in the Document Library for your convenience.
Difficulty Finding Your Product Or Lot/Batch Number?
How to Find the Product Number
Product numbers are combined with Pack Sizes/Quantity when displayed on the website (example: T1503-25G). Please make sure you enter ONLY the product number in the Product Number field (Example: T1503).
Example:
Additional examples:
705578-5MG-PW
PL860-CGA/SHF-1EA
MMYOMAG-74K-13
1000309185
enter as 1.000309185)
Having trouble? Feel free to contact Technical Service for assistance.
How to Find a Lot/Batch Number for COA
Lot and Batch Numbers can be found on a product's label following the words 'Lot' or 'Batch'.
Aldrich Products
For a lot number such as TO09019TO, enter it as 09019TO (without the first two letters 'TO').
For a lot number with a filling-code such as 05427ES-021, enter it as 05427ES (without the filling-code '-021').
For a lot number with a filling-code such as STBB0728K9, enter it as STBB0728 without the filling-code 'K9'.
Not Finding What You Are Looking For?
In some cases, a COA may not be available online. If your search was unable to find the COA you can request one.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service