WH0002212M6

Monoclonal Anti-FCGR2A antibody produced in mouse

clone 3E8, purified immunoglobulin, buffered aqueous solution

• Synonym(s): Anti-CD32, Anti-CDw32, Anti-FCG2, Anti-FCGR2, Anti-FCGR2A1, Anti-Fc fragment of IgG, low affinity IIa, receptor (CD32), Anti-FcGR, Anti-IGFR2, Anti-MGC23887, Anti-MGC30032
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: 3E8, monoclonal
• Application: indirect ELISA; western blot
• Species reactivity: human
• Technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Uniprot accession no.: P12318

Properties

• Product Name: Monoclonal Anti-FCGR2A antibody produced in mouse, clone 3E8, purified immunoglobulin, buffered aqueous solution
• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 3E8, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• GenBank accession no.: BC020823
• UniProt accession no.: P12318
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Quality Level: 100
• Gene Information: human ... FCGR2A(2212)

Description

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

This gene encodes one member of a family of immunoglobulin Fc receptor genes found on the surface of many immune response cells. The protein encoded by this gene is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Alternative splicing results in multiple transcript variants. (provided by RefSeq)

Immunogen

FCGR2A (AAH20823, 46 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPL

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Safety Information

• Storage Class: 10 - Combustible liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)