WH0002534M3

Monoclonal Anti-FYN antibody produced in mouse

clone 1A3, purified immunoglobulin, buffered aqueous solution

• Synonym(s): Anti-FYN oncogene related to SRC, FGR, YES, Anti-MGC45350, Anti-SLK, Anti-SYN
• UNSPSC Code: 12352203
• NACRES: NA.41
• MDL number: MFCD01633360
• Conjugate: unconjugated
• Clone: 1A3, monoclonal
• Application: ELISA (i), WB
• Citations: -

Properties

• biological source: mouse
• Quality Segment: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 1A3, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): indirect ELISA: suitable, western blot: 1-5 μg/mL
• isotype: IgGκ
• GenBank accession no.: BC032496
• UniProt accession no.: P06241
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... FYN(2534)

Description

General description

This gene is a member of the protein-tyrosine kinase oncogene family. It encodes a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein. Alternatively spliced transcript variants encoding distinct isoforms exist. (provided by RefSeq)

Immunogen

FYN (AAH32496, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQGLTVFGGVNSSSHTGTLRTRGGTGVTLFVAL

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Safety Information

• Storage Class: 10 - Combustible liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)