MilliporeSigma
All Photos(3)

Documents

WH0003280M1

Sigma-Aldrich

Monoclonal Anti-HES1 antibody produced in mouse

clone 4D9, purified immunoglobulin, buffered aqueous solution

Sign Into View Organizational & Contract Pricing

Synonym(s):
Anti-FLJ20408, Anti-HES1, Anti-HHL, Anti-HRY, Anti-hairy and enhancer of split 1, (Drosophila)
MDL number:
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

4D9, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2bκ

GenBank® accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... HES1(3280)

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item
SAB2108472SAB5700900HPA066929
vibrant-m

SAB2108472

Anti-HES1

antibody form

purified immunoglobulin

antibody form

IgG fraction of antiserum

antibody form

-

antibody form

affinity isolated antibody

conjugate

unconjugated

conjugate

unconjugated

conjugate

-

conjugate

unconjugated

biological source

mouse

biological source

rabbit

biological source

rabbit

biological source

rabbit

clone

4D9, monoclonal

clone

polyclonal

clone

monoclonal

clone

polyclonal

species reactivity

human

species reactivity

guinea pig, mouse, bovine, horse, human, rabbit, rat

species reactivity

human, rat, mouse

species reactivity

human

Still not finding the right product?  

Give our Product Selector Tool a try.

General description

Hairy and enhancer of split-1 (HES1) is a transcriptional repressor. It is a member of the basic helix-loop-helix family of transcription factors. This gene is mapped to human chromosome 3q29.
This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix interrupting protein that binds to the N-box rather than the canonical E-box. (provided by RefSeq)

Immunogen

HES1 (NP_005515, 36 a.a. ~ 142 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGH

Application

Monoclonal Anti-HES1 antibody has been used in western blotting.

Biochem/physiol Actions

Hairy and enhancer of split-1 (HES1) is required for regulating NPC (neural progenitor cells) fate and fetal brain development. This gene also helps to maintain the undifferentiated and proliferative status of NPCs. Absence of HES1 is linked with poor prognosis in colorectal adenocarcinoma.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class

10 - Combustible liquids

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Documents related to the products that you have purchased in the past have been gathered in the Document Library for your convenience.

Visit the Document Library

Difficulty Finding Your Product Or Lot/Batch Number?

Product numbers are combined with Pack Sizes/Quantity when displayed on the website (example: T1503-25G). Please make sure you enter ONLY the product number in the Product Number field (example: T1503).

Example:

T1503
Product Number
-
25G
Pack Size/Quantity

Additional examples:

705578-5MG-PW

PL860-CGA/SHF-1EA

MMYOMAG-74K-13

1000309185

enter as 1.000309185)

Having trouble? Feel free to contact Technical Service for assistance.

Lot and Batch Numbers can be found on a product's label following the words 'Lot' or 'Batch'.

Aldrich Products

  • For a lot number such as TO09019TO, enter it as 09019TO (without the first two letters 'TO').

  • For a lot number with a filling-code such as 05427ES-021, enter it as 05427ES (without the filling-code '-021').

  • For a lot number with a filling-code such as STBB0728K9, enter it as STBB0728 without the filling-code 'K9'.

Not Finding What You Are Looking For?

In some cases, a COA may not be available online. If your search was unable to find the COA you can request one.

Request COA

Loss of Hes1 expression is associated with poor prognosis in colorectal adenocarcinoma
Ahadi M, et al.
Human Pathology (2016)
HES1 promotes extracellular matrix protein expression and inhibits proliferation and migration in human trabecular meshwork cells under oxidative stress
Xu L, et al.
Oncotarget, 8(13), 21818-21833 (2017)
Anti-correlation between longevity gene SirT1 and Notch signaling in ascending aorta biopsies from patients with bicuspid aortic valve disease
Sciacca S, et al.
Heart and Vessels, 28(2), 268-275 (2013)
Human cytomegalovirus IE1 downregulates Hes1 in neural progenitor cells as a potential E3 ubiquitin ligase
Liu XJ, et al.
PLoS Pathogens (2017)
[Identification of a novel deletion region in 3q29 microdeletion syndrome by oligonucleotide array comparative genomic hybridization]
Seo EJ, et al.
The Korean Journal of Laboratory Medicine, 30(1), 70-75 (2010)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service