All Photos(3)

WH0008772M1

Sigma-Aldrich

Monoclonal Anti-FADD antibody produced in mouse

clone 3A12, purified immunoglobulin, buffered aqueous solution

Synonym(s):
Anti-Fas (TNFRSF6)-associated via death domain, Anti-MGC8528, Anti-MORT1, Anti-GIG3
MDL number:
NACRES:
NA.41

Quality Level

biological source

mouse

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

3A12, monoclonal

form

buffered aqueous solution

species reactivity

human

application(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG1λ

conjugate

unconjugated

GenBank® accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

Gene Information

human ... FADD(8772)

General description

The protein encoded by this gene is an adaptor molecule that interacts with various cell surface receptors and mediates cell apoptotic signals. Through its C-terminal death domain, this protein can be recruited by TNFRSF6/Fas-receptor, tumor necrosis factor receptor, TNFRSF25, and TNFSF10/TRAIL-receptor, and thus it participates in the death signaling initiated by these receptors. Interaction of this protein with the receptors unmasks the N-terminal effector domain of this protein, which allows it to recruit caspase-8, and thereby activate the cysteine protease cascade. Knockout studies in mice also suggest the importance of this protein in early T cell development. (provided by RefSeq)

Immunogen

FADD (AAH00334, 109 a.a. ~ 208 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Storage Class Code

12 - Non Combustible Liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US),Eyeshields,Gloves

Certificate of Analysis

Certificate of Origin

Xiao Yang Wang et al.
Clinical & experimental ophthalmology, 42(6), 529-538 (2013-11-15)
The aim of the study was to investigate, using a native mitomycin-C-resistant human Tenon's fibroblast cell line, the possibility that interferon-alpha and gamma could be used with Fas agonists as an alternative anti-fibrotic strategy to mitomycin-C in trabeculectomy. A clinically...
Changyou Li et al.
Molecular oncology, 8(7), 1220-1230 (2014-05-13)
Little is known regarding molecular markers in head and neck squamous cell carcinoma (HNSCC) that predict responsiveness to different therapeutic regimens or predict HNSCC progression. Mutations in procaspase-8 occur in 9% of HNSCC primary tumors, but the functional consequences of...

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service