WH0009026M1

Monoclonal Anti-HIP1R antibody produced in mouse

clone 3E10, purified immunoglobulin, buffered aqueous solution

• Synonym(s): Anti-FLJ14000, Anti-HIP12, Anti-HIP3, Anti-ILWEQ, Anti-KIAA0655, Anti-MGC47513, Anti-huntingtin interacting protein 1 related
• UNSPSC Code: 12352203
• NACRES: NA.41
• MDL number: MFCD04118470
• Conjugate: unconjugated
• Clone: 3E10, monoclonal
• Application: ELISA (i), WB
• Citations: -

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 3E10, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): indirect ELISA: suitable, western blot: 1-5 μg/mL
• isotype: IgG1κ
• GenBank accession no.: NM_003959
• UniProt accession no.: O75146
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... HIP1R(9026)

Description

Immunogen

HIP1R (NP_003950, 969 a.a. ~ 1066 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SGLSLIKLKKQEMETQVRVLELEKTLEAERMRLGELRKQHYVLAGASGSPGEEVAIRPSTAPRSVTTKKPPLAQKPSVAPRQDHQLDKKDGIYPAQLV

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Safety Information

• Storage Class: 10 - Combustible liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)