WH0009734M1

Monoclonal Anti-HDAC9 antibody produced in mouse

clone 2G10, purified immunoglobulin, buffered aqueous solution

• Synonym(s): Anti-DKFZp779K1053, Anti-HD7, Anti-HDAC, Anti-HDAC7, Anti-HDAC7B, Anti-HDAC9B, Anti-HDAC9FL, Anti-HDRP, Anti-KIAA0744, Anti-MITR, Anti-histone deacetylase 9
• MDL number: MFCD01633420
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 2G10, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): immunofluorescence: suitable; indirect ELISA: suitable
• isotype: IgG1κ
• GenBank accession no.: NM_058176
• UniProt accession no.: Q9UKV0
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... HDAC9(9734)

Description

General description

Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene has sequence homology to members of the histone deacetylase family. This gene is orthologous to the Xenopus and mouse MITR genes. The MITR protein lacks the histone deacetylase catalytic domain. It represses MEF2 activity through recruitment of multicomponent corepressor complexes that include CtBP and HDACs. This encoded protein may play a role in hematopoiesis. Multiple alternatively spliced transcripts have been described for this gene but the full-length nature of some of them has not been determined. (provided by RefSeq)

Immunogen

HDAC9 (NP_478056, 481 a.a. ~ 570 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QIHMNKLLSKSIEQLKQPGSHLEEAEEELQGDQAMQEDRAPSSGNSTRSDSSACVDDTLGQVGAVKVKEEPVDSDEDAQIQEMESGEQAA

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Safety Information

• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)