MilliporeSigma
All Photos(4)

Documents

WH0010397M3

Sigma-Aldrich

Monoclonal Anti-NDRG1 antibody produced in mouse

clone 2D7, purified immunoglobulin, buffered aqueous solution

Sign Into View Organizational & Contract Pricing

Select a Size

Synonym(s):
Anti-CAP43, Anti-CMT4D, Anti-DRG1, Anti-GC4, Anti-HMSNL, Anti-N-myc downstream regulated gene 1, Anti-NDR1, Anti-NMSL, Anti-PROXY1, Anti-RIT42, Anti-RTP, Anti-TARG1, Anti-TDD5
MDL number:
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2D7, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunofluorescence: suitable
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank® accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... NDRG1(10397)

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item
AP1160SAB5700474SAB5700461
conjugate

unconjugated

conjugate

-

conjugate

-

conjugate

-

antibody form

purified immunoglobulin

antibody form

purified antibody

antibody form

affinity isolated antibody

antibody form

affinity isolated antibody

clone

2D7, monoclonal

clone

2D7, monoclonal

clone

polyclonal

clone

polyclonal

form

buffered aqueous solution

form

liquid

form

buffered aqueous solution

form

buffered aqueous solution

species reactivity

human

species reactivity

human

species reactivity

human, mouse

species reactivity

human, mouse

General description

This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein involved in stress responses, hormone responses, cell growth, and differentiation. It is necessary for p53-mediated caspase activation and apoptosis. Mutation in this gene has been reported to be causative for hereditary motor and sensory neuropathy-Lom. Multiple alternatively spliced variants, encoding the same protein, have been identified. (provided by RefSeq)

Immunogen

NDRG1 (AAH03175, 1 a.a. ~ 394 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC

Application

Monoclonal Anti-NDRG1 antibody produced in mouse has been used in immunohistochemistry and Western blotting.

Biochem/physiol Actions

NDRG1 (N-myc downstream regulated 1) is a Rab4a (Ras-related protein Rab-4A) effector protein associated with cell proliferation, differentiation, and invasion. It localizes at the perinuclear recycling/sorting vesicles of trans Golgi network. NDRG1 is essentially required for the p53-dependent apoptosis. At the site of DNA damage, its elevated expression identifies the target genes required for mediating apoptosis. It also plays a major role in the recycling and stabilization of adhesion molecule E-cadherin. In endosome recycling, NDRG1 interacts with the membrane bound Rab4aGTPase. Reports show that NDRG1 acts as a biomarker in the development of colorectal cancer (CRC).

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Documents related to the products that you have purchased in the past have been gathered in the Document Library for your convenience.

Visit the Document Library

Difficulty Finding Your Product Or Lot/Batch Number?

Product numbers are combined with Pack Sizes/Quantity when displayed on the website (example: T1503-25G). Please make sure you enter ONLY the product number in the Product Number field (example: T1503).

Example:

T1503
Product Number
-
25G
Pack Size/Quantity

Additional examples:

705578-5MG-PW

PL860-CGA/SHF-1EA

MMYOMAG-74K-13

1000309185

enter as 1.000309185)

Having trouble? Feel free to contact Technical Service for assistance.

Lot and Batch Numbers can be found on a product's label following the words 'Lot' or 'Batch'.

Aldrich Products

  • For a lot number such as TO09019TO, enter it as 09019TO (without the first two letters 'TO').

  • For a lot number with a filling-code such as 05427ES-021, enter it as 05427ES (without the filling-code '-021').

  • For a lot number with a filling-code such as STBB0728K9, enter it as STBB0728 without the filling-code 'K9'.

Not Finding What You Are Looking For?

In some cases, a COA may not be available online. If your search was unable to find the COA you can request one.

Request COA

N-myc downstream-regulated gene 1 downregulates cell proliferation, invasiveness, and tumorigenesis in human oral squamous cell carcinoma.
Jehn-Chuan Lee
Cancer Letters, 355 (2014)
NDRG1 is necessary for p53-dependent apoptosis
The Journal of Biological Chemistry, 279 (2004)
N-myc downstream-regulated gene 1 promotes apoptosis in colorectal cancer via up-regulating death receptor 4
Oncotarget, 8(47), 82593?82608-82593?82608 (2017)
Xian Zhang et al.
Oncotarget, 8(47), 82593-82608 (2017-11-16)
The aim of this study was to evaluate the clinical significance of N-myc downstream-regulated gene 1 (NDRG1) in colorectal cancer (CRC) patients and to explore the mechanisms governing the role of NDRG1 in apoptosis of CRC cells. In the current
The metastasis suppressor, N-myc downregulated gene 1 (NDRG1), is a prognostic biomarker for human colorectal cancer
Zhihai Mao
PLoS ONE, 8 (2013)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service