MilliporeSigma
All Photos(5)

Documents

WH0010840M1

Sigma-Aldrich

Monoclonal Anti-ALDH1L1 antibody produced in mouse

clone 3E9, purified immunoglobulin, buffered aqueous solution

Sign Into View Organizational & Contract Pricing

Select a Size

Synonym(s):
Anti-DKFZp781N0997, Anti-FTHFD, Anti-aldehyde dehydrogenase 1 family, member L1

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

3E9, monoclonal

form

buffered aqueous solution

species reactivity

mouse

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

isotype

IgG3κ

GenBank® accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ALDH1L1(10840)

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item
AV52331SAB5701644MABN495
conjugate

unconjugated

conjugate

unconjugated

conjugate

-

conjugate

-

antibody form

purified immunoglobulin

antibody form

affinity isolated antibody

antibody form

-

antibody form

purified immunoglobulin

clone

3E9, monoclonal

clone

polyclonal

clone

monoclonal

clone

N103/39, monoclonal

form

buffered aqueous solution

form

buffered aqueous solution

form

liquid

form

-

species reactivity

mouse

species reactivity

bovine, horse, guinea pig, mouse, rat, sheep, dog, human

species reactivity

human, mouse, rat

species reactivity

human, rat, mouse

General description

The protein encoded by this gene catalyzes the conversion of 10-formyltetrahydrofolate, NADP, and water to tetrahydrofolate, NADPH, and carbon dioxide. The encoded protein belongs to the aldehyde dehydrogenase family and is responsible for formate oxidation in vivo. Deficiencies in this gene can result in an accumulation of formate and subsequent methanol poisoning. (provided by RefSeq)

Immunogen

ALDH1L1 (NP_036322, 803 a.a. ~ 902 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EESFGPVMIISRFADGDLDAVLSRANATEFGLASGVFTRDINKALYVSDKLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRVKTVTFEY

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Documents related to the products that you have purchased in the past have been gathered in the Document Library for your convenience.

Visit the Document Library

Difficulty Finding Your Product Or Lot/Batch Number?

Product numbers are combined with Pack Sizes/Quantity when displayed on the website (example: T1503-25G). Please make sure you enter ONLY the product number in the Product Number field (example: T1503).

Example:

T1503
Product Number
-
25G
Pack Size/Quantity

Additional examples:

705578-5MG-PW

PL860-CGA/SHF-1EA

MMYOMAG-74K-13

1000309185

enter as 1.000309185)

Having trouble? Feel free to contact Technical Service for assistance.

Lot and Batch Numbers can be found on a product's label following the words 'Lot' or 'Batch'.

Aldrich Products

  • For a lot number such as TO09019TO, enter it as 09019TO (without the first two letters 'TO').

  • For a lot number with a filling-code such as 05427ES-021, enter it as 05427ES (without the filling-code '-021').

  • For a lot number with a filling-code such as STBB0728K9, enter it as STBB0728 without the filling-code 'K9'.

Not Finding What You Are Looking For?

In some cases, a COA may not be available online. If your search was unable to find the COA you can request one.

Request COA

Mar Bosch-Queralt et al.
Nature metabolism, 3(2), 211-227 (2021-02-24)
Proregenerative responses are required for the restoration of nervous-system functionality in demyelinating diseases such as multiple sclerosis (MS). Yet, the limiting factors responsible for poor CNS repair are only partially understood. Here, we test the impact of a Western diet

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service