Skip to Content
MilliporeSigma
All Photos(2)

Documents

WH0011218M1

Sigma-Aldrich

Monoclonal Anti-DDX20 antibody produced in mouse

clone 5H5, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-DEAD (Asp-Glu-Ala-Asp) box polypeptide 20, Anti-DKFZp434H052, Anti-DP103, Anti-GEMIN3

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

5H5, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunofluorescence: suitable
indirect ELISA: suitable

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... DDX20(11218)

General description

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which has an ATPase activity and is a component of the survival of motor neurons (SMN) complex. This protein interacts directly with SMN, the spinal muscular atrophy gene product, and may play a catalytic role in the function of the SMN complex on RNPs. (provided by RefSeq)

Immunogen

DDX20 (NP_009135, 725 a.a. ~ 824 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EGASQRAKQSRRNLPRRSSFRLQTEAQEDDWYDCHREIRLSFSDTYQDYEEYWRAYYRAWQEYYAAASHSYYWNAQRHPSWMAAYHMNTIYLQEMMHSNQ

Biochem/physiol Actions

The gene DDX20 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 20) encodes a RNA helicase that forms a part of the SMN (survival-of-motor-neurons) complex, which is involved in the processing and assembly of RNPs (ribonucleoproteins), such as, snRNPs (spliceosomes), snoRNPs, miRNPs, hnRNPs and transcriptosomes. It plays an essential role in early embryonic development, where it is involved in silencing of maternal transcripts and processing of RNA. DDX20 plays a part in hind brain development where it suppresses the transcription of Egr2 (early growth response 2) gene. It regulates macrophage differentiation and proliferation by silencing the expression of Ets target genes involved in Ras pathway. It also acts as a cofactor in the SUMOylation of SF-1 (steroidogenic factor 1) by PIASy (protein inhibitor of activated STAT Y). This protein facilitates the assembly of the core of SMN complex, and this activity of DDX20 is associated with spinal muscular atrophy (SMA). DDX20 acts as an oncogene that facilitates metastasis, in human breast cancer, and has potential as a therapeutic target for the same.

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Karl B Shpargel et al.
Proceedings of the National Academy of Sciences of the United States of America, 102(48), 17372-17377 (2005-11-23)
Spinal muscular atrophy (SMA) is a neurodegenerative disease characterized by loss of spinal motor neurons. The gene encoding the survival of motor neurons (SMN) protein is mutated in >95% of SMA cases. SMN is the central component of a large
Jean-François Mouillet et al.
Endocrinology, 149(5), 2168-2175 (2008-02-09)
The DEAD-box helicase DP103 (Ddx20, Gemin3) is a multifunctional protein that interacts with Epstein-Barr virus nuclear proteins (EBNA2/EBNA3) and is a part of the spliceosomal small nuclear ribonucleoproteins complex. DP103 also aggregates with the micro-RNA machinery complex. We have previously
Xiankui Sun et al.
Cell stress & chaperones, 15(5), 567-582 (2010-02-17)
A number of missense mutations in the two related small heat shock proteins HspB8 (Hsp22) and HspB1 (Hsp27) have been associated with the inherited motor neuron diseases (MND) distal hereditary motor neuropathy and Charcot-Marie-Tooth disease. HspB8 and HspB1 interact with
Eun Myoung Shin et al.
The Journal of clinical investigation, 124(9), 3807-3824 (2014-08-02)
Despite advancement in breast cancer treatment, 30% of patients with early breast cancers experience relapse with distant metastasis. It is a challenge to identify patients at risk for relapse; therefore, the identification of markers and therapeutic targets for metastatic breast

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service