MilliporeSigma
All Photos(4)

Documents

WH0056913M1

Sigma-Aldrich

Monoclonal Anti-C1GALT1 antibody produced in mouse

clone 1F1, purified immunoglobulin, buffered aqueous solution

Sign Into View Organizational & Contract Pricing

Synonym(s):
Anti-C1GALT, Anti-Tsynthase, Anti-core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase, 1
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

1F1, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank® accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... C1GALT1(56913)

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item
HPA012819HPA011294WH0011320M2
biological source

mouse

biological source

rabbit

biological source

rabbit

biological source

mouse

antibody form

purified immunoglobulin

antibody form

affinity isolated antibody

antibody form

affinity isolated antibody

antibody form

purified immunoglobulin

clone

1F1, monoclonal

clone

polyclonal

clone

polyclonal

clone

4H4, monoclonal

species reactivity

human

species reactivity

human

species reactivity

human

species reactivity

human

conjugate

unconjugated

conjugate

unconjugated

conjugate

unconjugated

conjugate

unconjugated

Still not finding the right product?  

Give our Product Selector Tool a try.

General description

Glycoprotein-N- acetylgalactosamine 3-β- galactosyltransferase 1 (C1GALT1) is localized in the Golgi apparatus. The gene encoding it contains three exons spanning 10 kb. It is located on chromosome 7p14-p13.

Immunogen

C1GALT1 (NP_064541, 264 a.a. ~ 363 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGCCSDLAVSFHYVDSTTMYELEYLVYHLRPYGYLYRYQPTLPERILKEISQANKNEDTKVKLGNP

Biochem/physiol Actions

Glycoprotein-N- acetylgalactosamine 3-β- galactosyltransferase 1 (C1GALT1) functions in the addition of galactose onto GalNAc residues of IgA1. Thus, it generates the core 1 O-glycan Galβ1-3GalNAα1-SerThr (T antigen), which is a precursor for many extended O-glycans in glycoproteins. A deficiency of C1GALT1 results in IgA nephropathy, Tn syndrome and also Henoch-Schönlein purpura. It increases the proliferation of hepatocellular carcinoma cells by regulating MET glycosylation and dimerization. C1GALT1 also regulates angiogenesis, kidney development and thrombopoiesis.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class

10 - Combustible liquids

wgk_germany

nwg

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Documents related to the products that you have purchased in the past have been gathered in the Document Library for your convenience.

Visit the Document Library

Difficulty Finding Your Product Or Lot/Batch Number?

Product numbers are combined with Pack Sizes/Quantity when displayed on the website (example: T1503-25G). Please make sure you enter ONLY the product number in the Product Number field (example: T1503).

Example:

T1503
Product Number
-
25G
Pack Size/Quantity

Additional examples:

705578-5MG-PW

PL860-CGA/SHF-1EA

MMYOMAG-74K-13

1000309185

enter as 1.000309185)

Having trouble? Feel free to contact Technical Service for assistance.

Lot and Batch Numbers can be found on a product's label following the words 'Lot' or 'Batch'.

Aldrich Products

  • For a lot number such as TO09019TO, enter it as 09019TO (without the first two letters 'TO').

  • For a lot number with a filling-code such as 05427ES-021, enter it as 05427ES (without the filling-code '-021').

  • For a lot number with a filling-code such as STBB0728K9, enter it as STBB0728 without the filling-code 'K9'.

Not Finding What You Are Looking For?

In some cases, a COA may not be available online. If your search was unable to find the COA you can request one.

Request COA

C1GALT1 enhances proliferation of hepatocellular carcinoma cells via modulating MET glycosylation and dimerization.
Wu YM, et.al
Cancer Research, 73(17), 5580-5590 (2013)
Variants of C1GALT1 gene are associated with the genetic susceptibility to IgA nephropathy.
Li GS, et.al
Kidney International, 71(5), 448-453 (2007)
Variants of C1GALT1 gene are associated with the genetic susceptibility to IgA nephropathy.
Li GS, et al.
Kidney International, 71(5), 448-453 (2007)
Interaction between variants of two glycosyltransferase genes in IgA nephropathy.
Zhu L, et.al
Kidney International, 76(2), 190-198 (2009)
Tongzhong Ju et al.
Proceedings of the National Academy of Sciences of the United States of America, 99(26), 16613-16618 (2002-12-05)
Human core 1 beta3-galactosyltransferase (C1beta3Gal-T) generates the core 1 O-glycan Galbeta1-3GalNAcalpha1-SerThr (T antigen), which is a precursor for many extended O-glycans in animal glycoproteins. We report here that C1beta3Gal-T activity requires expression of a molecular chaperone designated Cosmc (core 1

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service