WH0152503M1

Monoclonal Anti-SH3D19 antibody produced in mouse

clone 5C7, purified immunoglobulin, buffered aqueous solution

• Synonym(s): Anti-EVE1, Anti-MGC105136, Anti-MGC118910, Anti-SH3 domain protein D19
• UNSPSC Code: 12352203
• NACRES: NA.43

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 5C7, monoclonal
• form: buffered aqueous solution
• species reactivity: human, mouse, rat
• technique(s): indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• isotype: IgG3κ
• GenBank accession no.: NM_001009555
• UniProt accession no.: Q5HYK7
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SH3D19(152503)

Description

General description

SH3 domain containing 19 (SH3D19) is a cytoplasmic protein and the gene encoding it is localized on human chromosome 4q31.3.

Immunogen

SH3D19 (NP_001009555, 94 a.a. ~ 203 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PVTKPELPKKPNPGLIRSVNPEIPGRGPLAESSDSGKKVPTPAPRPLLLKKSVSSENPTYPSAPLKPVTVPPRLAGASQAKAYKSLGEGPPANPPVPVLQSKPLVDIDLI

Biochem/physiol Actions

SH3 domain containing 19 (SH3D19) inhibits processes induced by Ras oncoprotein. It binds to a protein called EEN (extra eleven-nineteen leukemia fusion gene protein), part of the endophilin family, and modulates the activity of ADAMs (a disintegrin and metalloproteases).

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: nwg
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)