WH0245972M1

Monoclonal Anti-ATP6V0D2 antibody produced in mouse

clone 7A4, purified immunoglobulin, buffered aqueous solution

• Synonym(s): Anti-ATP6D2, Anti-ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2, Anti-FLJ38708, Anti-VMA6
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: 7A4, monoclonal
• Application: ELISA (i), WB
• Citations: 2

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 7A4, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): indirect ELISA: suitable, western blot: 1-5 μg/mL
• isotype: IgG2bκ
• GenBank accession no.: NM_152565
• UniProt accession no.: Q8N8Y2
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ATP6V0D2(245972)

Description

General description

ATPase H⁺ transporting V0 subunit d2 (ATP6V0D2) is expressed on the cell surface of kidneys and osteoclasts. The gene encoding it is localized on human chromosome 8q21.

Immunogen

ATP6V0D2 (NP_689778, 238 a.a. ~ 306 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ETLYPTFGKLYPEGLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQMNVLAFN

Biochem/physiol Actions

ATPase H⁺ transporting V0 subunit d2 (ATP6V0D2) takes part in H⁺ translocation. It also has an important role in the maturation of osteoclasts and development of bones.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk: nwg
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)