All Photos(1)

WH0283807M1

Sigma-Aldrich

Monoclonal Anti-FBXL22 antibody produced in mouse

clone 1B6, purified immunoglobulin, buffered aqueous solution

Synonym(s):
Anti-Fbl22, Anti-F-box and leucine-rich repeat protein 22, Anti-MGC75496, Anti-FLJ39626
NACRES:
NA.41

Quality Level

biological source

mouse

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

1B6, monoclonal

form

buffered aqueous solution

species reactivity

human

application(s)

immunofluorescence: suitable
indirect ELISA: suitable

isotype

IgG2aκ

conjugate

unconjugated

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

Gene Information

human ... FBXL22(283807)

General description

Members of the F-box protein family, such as FBXL22, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM

Immunogen

FBXL22 (NP_976307, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MHITQLNRECLLHLFSFLDKDSRKSLARTCSQLHDVFEDPALWSLLHFRSLTELQKDNFLLGPALRSLSICWHSSRVQVCSIEDWLKSAFQRSICSRHESLVNDFLLRVC

Biochem/physiol Actions

F-box and leucine-rich repeat protein 22 (FBXL22) enhances the degradation of sarcomeric proteins and has a role in contraction of cardiac muscles.

Physical form

Solution in phosphate buffered saline, pH 7.4

Storage Class Code

12 - Non Combustible Liquids

WGK Germany

nwg

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US),Eyeshields,Gloves

Certificate of Analysis

Certificate of Origin

Kazuyuki Sato et al.
International journal of oncology, 37(5), 1071-1076 (2010-09-30)
Cells are tightly regulated by sophisticated systems. Among such systems, post-translational modification has been intensively studied, and the ubiquitin-proteasome system is one of the best-known proteolytic mechanisms for the timely destruction of regulatory proteins. As progress has been made in...
Sebastian Spaich et al.
Circulation research, 111(12), 1504-1516 (2012-09-14)
The emerging role of the ubiquitin-proteasome system in cardiomyocyte function and homeostasis implies the necessity of tight regulation of protein degradation. However, little is known about cardiac components of this machinery. We sought to determine whether molecules exist that control...

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service