MilliporeSigma
Search Within
Shipping
Product Category
Brand
Biological Source
Color
Feature
Formula Weight
Gene Alias
Melting Point (°C)
pH Value
Physical Form
Purity
Agency
Analyte Suitability
Research Area
Quality Segment
Application
Markush Class
Markush Group
Optical Isomer
Amino Acid
Special Grade
Technique
Available for Sale

200-294-2

Applied Filters:
Keyword:'200-294-2'
Showing 1-22 of 22 results for "200-294-2" within Products
All Photos(6)

Empirical Formula (Hill Notation): CaCl2 · 2H2O
CAS No.:
10035-04-8
Molecular Weight:
147.01
EC No.:
233-140-8
All Photos(1)

3-Aminopropylphosphonic acid

Linear Formula: H2N(CH2)3P(O)(OH)2
CAS No.:
13138-33-5
Molecular Weight:
139.09
CompareProduct No.DescriptionSDSPricing
26861598%
All Photos(1)

trans-Azobenzene

Synonym(s): trans-Azobenzene
Linear Formula: C6H5N=NC6H5
CAS No.:
103-33-3
Molecular Weight:
182.22
CompareProduct No.DescriptionSDSPricing
8.20118for synthesis
All Photos(1)

1,7-Dimethylxanthine-(dimethyl-d6)

Synonym(s): 1,7-Dimethyl-1H-purine-2,6-dione-(dimethyl-d6), 2,6-Dihydroxy-1,7-dimethylpurine-(dimethyl-d6), Paraxanthine-(dimethyl-d6)
Empirical Formula (Hill Notation): C7D6H2N4O2
CAS No.:
117490-41-2
Molecular Weight:
186.20
CompareProduct No.DescriptionSDSPricing
705373≥98 atom % D, ≥97% (CP)
All Photos(1)

Triethyl citrate

Synonym(s): Triethyl citrate
Linear Formula: HOC(COOC2H5)(CH2COOC2H5)2
CAS No.:
77-93-0
Molecular Weight:
276.28
CompareProduct No.DescriptionSDSPricing
8.00251for synthesis
All Photos(1)

1,7-Dimethylxanthine-2,4,5,6-13C4-1,3,9-15N3

Synonym(s): 1,7-Dimethyl-1H-purine-2,6-dione-13C4,15N3 (2,4,5,6-13C4, 1,3,9-15N3), 2,6-Dihydroxy-1,7-dimethylpurine-13C4,15N3 (2,4,5,6-13C4, 1,3,9-15N3), Paraxanthine-13C4,15N3 (2,4,5,6-13C4, 1,3,9-15N3)
Empirical Formula (Hill Notation): 13C4C3H815N3NO2
CAS No.:
1173018-79-5
Molecular Weight:
187.11
CompareProduct No.DescriptionSDSPricing
705381≥98 atom %, ≥98% (CP)
All Photos(2)

o-Cresolphthalein

Empirical Formula (Hill Notation): C22H18O4
CAS No.:
596-27-0
Molecular Weight:
346.38
EC No.:
209-881-8
Beilstein No.:
310554
CompareProduct No.DescriptionSDSPricing
C85778indicator grade
All Photos(3)

1,7-Dimethylxanthine

Synonym(s): 1,7-Dimethyl-1H-purine-2,6-dione, 1,7-Dimethyl-3,7-dihydro-1H-purine-2,6-dione, 2,6-Dihydroxy-1,7-dimethylpurine, NSC 400018, Paraxanthine
Empirical Formula (Hill Notation): C7H8N4O2
CAS No.:
611-59-6
Molecular Weight:
180.16
EC No.:
210-271-9
Beilstein No.:
197907
CompareProduct No.DescriptionSDSPricing
D5385~98%, solid
All Photos(3)

Phenol Red

Synonym(s): Phenolsulfonphthalein
Empirical Formula (Hill Notation): C19H14O5S
CAS No.:
143-74-8
Molecular Weight:
354.38
EC No.:
205-609-7
Beilstein No.:
326470
CompareProduct No.DescriptionSDSPricing
114529ACS reagent
All Photos(1)

Timolol maleate salt

Synonym(s): S-(−)-1-(t-Butylamino)-3-[(4-morpholino-1,2,5-thiadiazol-3-yl)oxy]-2-propanol maleate salt, Timolol hydrogen maleate
Empirical Formula (Hill Notation): C13H24N4O3S · C4H4O4
CAS No.:
26921-17-5
Molecular Weight:
432.49
EC No.:
248-111-5
CompareProduct No.DescriptionSDSPricing
T6394≥98% (TLC), powder
All Photos(4)

Synonym(s): (S)-2,6-Diaminocaproic acid
Linear Formula: H2N(CH2)4CH(NH2)CO2H
CAS No.:
56-87-1
Molecular Weight:
146.19
EC No.:
200-294-2
Beilstein No.:
1722531
All Photos(4)

L-Lysine monohydrate

Empirical Formula (Hill Notation): C6H14N2O2 · H2O
CAS No.:
39665-12-8
Molecular Weight:
164.20
EC No.:
200-294-2
Beilstein No.:
4349963
All Photos(1)

Exendin-4

Empirical Formula (Hill Notation): C184H282N50O60S
CAS No.:
141758-74-9
Molecular Weight:
4186.57
CompareProduct No.DescriptionSDSPricing
E7144≥97%
All Photos(1)

SNX-482

Synonym(s): SNX-482
Empirical Formula (Hill Notation): C192H274N52O60S7
CAS No.:
203460-30-4
Molecular Weight:
4495.00
CompareProduct No.DescriptionSDSPricing
5.08512
All Photos(1)

SNX-482 Recombinant

Synonym(s): GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD
Empirical Formula (Hill Notation): C192H274N52O60S7
CAS No.:
203460-30-4
Molecular Weight:
4495.00
CompareProduct No.DescriptionSDSPricing
SML1150≥98% (HPLC)
All Photos(1)

Synonym(s): Neuropeptide Y, Human, NPY, hNPY
Empirical Formula (Hill Notation): C189H285N55O57S
CAS No.:
90880-35-6
Molecular Weight:
4271.68
All Photos(1)

Adrenocorticotropic Hormone human

Synonym(s): Adrenocorticotropic hormone fragment 1-39, Corticotropin A
Empirical Formula (Hill Notation): C207H308N56O58S
CAS No.:
12279-41-3
Molecular Weight:
4541.07
CompareProduct No.DescriptionSDSPricing
A0423≥97% (HPLC)
All Photos(1)

Charybdotoxin

Empirical Formula (Hill Notation): C176H277N57O55S7
CAS No.:
95751-30-7
Molecular Weight:
4295.89
CompareProduct No.DescriptionSDSPricing
C7802≥90% (HPLC)
All Photos(1)

bis-MPA-Acetylene dendrimer

Empirical Formula (Hill Notation): C279H326O138
Molecular Weight:
5887.49
CompareProduct No.DescriptionSDSPricing
806153trimethylol propane core, generation 3
All Photos(1)

Glucagon-Like Peptide I human

Synonym(s): GLP-1, Preproglucagon 72-108
Empirical Formula (Hill Notation): C186H275N51O59
CAS No.:
87805-34-3
Molecular Weight:
4169.48
CompareProduct No.DescriptionSDSPricing
G3265≥97% (HPLC)
All Photos(1)

Exenatide

Synonym(s): Exendin-4
Empirical Formula (Hill Notation): C184H282N50O60S
CAS No.:
141758-74-9
Molecular Weight:
4186.57
CompareProduct No.DescriptionPricing
1269105United States Pharmacopeia (USP) Reference Standard
All Photos(1)

Hyperbranched bis-MPA polyester-64-hydroxyl, generation 4

Synonym(s): ALH-64-OH, Hyperbranched Polymer, Hyperpolymer, PFH-64-OH
Empirical Formula (Hill Notation): C315H512O189
CAS No.:
326794-48-3
Molecular Weight:
7323.32
CompareProduct No.DescriptionSDSPricing
686573≥97%
Page 1 of 1