MilliporeSigma
Search Within
Shipping
Product Category
Brand
Boiling Point (°C)
Color
Feature
Formula Weight
Gene Alias
Melting Point (°C)
Physical Form
Purity
Research Area
Quality Segment
Application
API Family
Reference Material Type
Special Grade
Available for Sale

233-256-9

Applied Filters:
Keyword:'233-256-9'
Showing 1-26 of 26 results for "233-256-9" within Products
All Photos(1)

Exenatide

Synonym(s): Exendin-4
Empirical Formula (Hill Notation): C184H282N50O60S
CAS No.:
141758-74-9
Molecular Weight:
4186.57
CompareProduct No.DescriptionPricing
1269105United States Pharmacopeia (USP) Reference Standard
All Photos(1)

Parathyroid Hormone Fragment 1-34 bovine

Empirical Formula (Hill Notation): C183H288N54O50S2
CAS No.:
12583-68-5
Molecular Weight:
4108.71
CompareProduct No.DescriptionSDSPricing
P3671≥97% (HPLC), powder
All Photos(1)

SNX-482

Synonym(s): SNX-482
Empirical Formula (Hill Notation): C192H274N52O60S7
CAS No.:
203460-30-4
Molecular Weight:
4495.00
CompareProduct No.DescriptionSDSPricing
5.08512
All Photos(1)

Parathyroid Hormone 1-34, Human

Synonym(s): Parathyroid Hormone 1-34, Human
Empirical Formula (Hill Notation): C181H291N55O51S2
CAS No.:
52232-67-4
Molecular Weight:
4117.72
All Photos(1)

SNX-482 Recombinant

Synonym(s): GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD
Empirical Formula (Hill Notation): C192H274N52O60S7
CAS No.:
203460-30-4
Molecular Weight:
4495.00
CompareProduct No.DescriptionSDSPricing
SML1150≥98% (HPLC)
All Photos(4)

Linear Formula: PbI2
CAS No.:
10101-63-0
Molecular Weight:
461.01
EC No.:
233-256-9
All Photos(1)

Glucagon-Like Peptide I human

Synonym(s): GLP-1, Preproglucagon 72-108
Empirical Formula (Hill Notation): C186H275N51O59
CAS No.:
87805-34-3
Molecular Weight:
4169.48
CompareProduct No.DescriptionSDSPricing
G3265≥97% (HPLC)
All Photos(1)

Exendin-4

Empirical Formula (Hill Notation): C184H282N50O60S
CAS No.:
141758-74-9
Molecular Weight:
4186.57
CompareProduct No.DescriptionSDSPricing
E7144≥97%
All Photos(1)

Synonym(s): Parathyroid Hormone Fragment 1-34 human, PTH 1-34, Parathormone (1-34)
Empirical Formula (Hill Notation): C181H291N55O51S2
CAS No.:
52232-67-4
Molecular Weight:
4117.72
All Photos(1)

Synonym(s): NPY, hNPY, Neuropeptide Y, Human
Empirical Formula (Hill Notation): C189H285N55O57S
CAS No.:
90880-35-6
Molecular Weight:
4271.68
CompareProduct No.DescriptionSDSPricing
N5017≥95% (HPLC), powder, synthetic
05-23-2005A potent vasoconstrictor.
All Photos(1)

Chlorotoxin from Leiurus quinquestriatus (north Africa)

Empirical Formula (Hill Notation): C158H256N52O48S11
CAS No.:
163515-35-3
Molecular Weight:
4004.76
CompareProduct No.DescriptionSDSPricing
C5238recombinant, expressed in E. coli, ≥98% (HPLC), lyophilized powder
All Photos(1)

Adrenocorticotropic Hormone human

Synonym(s): Adrenocorticotropic hormone fragment 1-39, Corticotropin A
Empirical Formula (Hill Notation): C207H308N56O58S
CAS No.:
12279-41-3
Molecular Weight:
4541.07
CompareProduct No.DescriptionSDSPricing
A0423≥97% (HPLC)
All Photos(1)

Iberiotoxin, Buthus tamulus, Recombinant, E. coli

Synonym(s): Iberiotoxin, Buthus tamulus, Recombinant, E. coli
CAS No.:
129203-60-7
CompareProduct No.DescriptionSDSPricing
401002
All Photos(1)

Teriparatide for system suitability

Synonym(s): Parathyroid Hormone Fragment 1-34 human, PTH 1-34, Parathormone (1-34)
Empirical Formula (Hill Notation): C181H291N55O51S2
CAS No.:
52232-67-4
Molecular Weight:
4117.72
CompareProduct No.DescriptionSDSPricing
Y0001895European Pharmacopoeia (EP) Reference Standard
All Photos(1)

Calcitonin Gene Related Peptide human

Synonym(s): α-CGRP, CGRP-I
Empirical Formula (Hill Notation): C163H267N51O49S2
CAS No.:
90954-53-3
Molecular Weight:
3789.31
CompareProduct No.DescriptionSDSPricing
C0167≥95% (HPLC), powder
All Photos(1)

Parathyroid Hormone Fragment 1-34 human

Synonym(s): PTH 1-34, Parathormone (1-34)
Empirical Formula (Hill Notation): C181H291N55O51S2
CAS No.:
52232-67-4
Molecular Weight:
4117.72
CompareProduct No.DescriptionSDSPricing
P3796≥95% (HPLC), powder
All Photos(1)

Hypercalcemia of malignancy factor fragment 1-34 amide human

Synonym(s): Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-NH2, PTHrP (1-34) amide, Parathyroid hormone-related protein (1-34) Amide
Empirical Formula (Hill Notation): C180H288N58O47
CAS No.:
112955-31-4
Molecular Weight:
4016.57
CompareProduct No.DescriptionSDSPricing
H9148≥97% (HPLC)
All Photos(1)

Charybdotoxin

Empirical Formula (Hill Notation): C176H277N57O55S7
CAS No.:
95751-30-7
Molecular Weight:
4295.89
CompareProduct No.DescriptionSDSPricing
C7802≥90% (HPLC)
All Photos(1)

Cecropin A

Empirical Formula (Hill Notation): C184H313N53O46
CAS No.:
80451-04-3
Molecular Weight:
4003.78
CompareProduct No.DescriptionSDSPricing
C6830≥97% (HPLC), powder
All Photos(1)

Pramlintide acetate salt

Synonym(s): 25,28,29 TriPro-amylin (human) acetate, AC 0137, AC 137, AC0137, AC137, TriPro-amylin acetate, [Pro25,28,29]-amylin (human) acetate
Empirical Formula (Hill Notation): C171H267N51O53S2
CAS No.:
187887-46-3
Molecular Weight:
3949.39
CompareProduct No.DescriptionSDSPricing
SML2523≥95% (HPLC)
All Photos(1)

Cecropin B

Empirical Formula (Hill Notation): C176H301N51O42S
CAS No.:
80451-05-4
Molecular Weight:
3835.65
CompareProduct No.DescriptionSDSPricing
C1796≥97% (HPLC), powder
All Photos(1)

Margatoxin

Synonym(s): MgTx
Empirical Formula (Hill Notation): C178H286N52O50S7
CAS No.:
145808-47-5
Molecular Weight:
4178.95
CompareProduct No.DescriptionSDSPricing
M8278
All Photos(1)

Diabetes Associated Peptide Amide human

Synonym(s): Amylin, DAP, IAPP, Insulinoma or Islet amyloid polypeptide
Empirical Formula (Hill Notation): C165H261N51O55S2
CAS No.:
122384-88-7
Molecular Weight:
3903.28
CompareProduct No.DescriptionSDSPricing
D2162≥97% (HPLC)
All Photos(1)

Copeptin trifluoroacetate human

Synonym(s): H-Ala-Ser-Asp-Arg-Ser-Asn-Ala-Thr-Gln-Leu-Asp-Gly-Pro-Ala-Gly-Ala-Leu-Leu-Leu-Arg-Leu-Val-Gln-Leu-Ala-Gly-Ala-Pro-Glu-Pro-Phe-Glu-Pro-Ala-Gln-Pro-Asp-Ala-Tyr-OH trifluoroacetate
Empirical Formula (Hill Notation): C177H279N49O58 · xC2HF3O2
CAS No.:
78362-34-2
Molecular Weight:
4021.40 (free base basis)
CompareProduct No.DescriptionSDSPricing
C8749≥95% (HPLC)
All Photos(1)

Calcitonin Gene-Related Peptide-I, Human

Synonym(s): Calcitonin Gene-Related Peptide-I, Human
Empirical Formula (Hill Notation): C163H267N51O49S2
CAS No.:
90954-53-3
Molecular Weight:
3789.31
All Photos(1)

bis-MPA-Acetylene dendrimer

Empirical Formula (Hill Notation): C279H326O138
Molecular Weight:
5887.49
CompareProduct No.DescriptionSDSPricing
806153trimethylol propane core, generation 3
Page 1 of 1