MilliporeSigma
Search Within
Shipping
Product Category
Brand
Biological Source
Color
Feature
Formula Weight
Gene Alias
pH Value
Physical Form
pK Value
Purity
Research Area
Quality Segment
Application
API Family
Special Grade
Technique
Available for Sale

278-169-7

Applied Filters:
Keyword:'278-169-7'
Showing 1-19 of 19 results for "278-169-7" within Products
All Photos(10)

Synonym(s): 4-(2-Hydroxyethyl)piperazine-1-ethanesulfonic acid sodium salt, N-(2-Hydroxyethyl)piperazine-N′-(2-ethanesulfonic acid) sodium salt
Empirical Formula (Hill Notation): C8H17N2NaO4S
CAS No.:
75277-39-3
Molecular Weight:
260.29
EC No.:
278-169-7
All Photos(1)

SNX-482

Synonym(s): SNX-482
Empirical Formula (Hill Notation): C192H274N52O60S7
CAS No.:
203460-30-4
Molecular Weight:
4495.00
CompareProduct No.DescriptionSDSPricing
5.08512
All Photos(1)

Iberiotoxin, Buthus tamulus, Recombinant, E. coli

Synonym(s): Iberiotoxin, Buthus tamulus, Recombinant, E. coli
CAS No.:
129203-60-7
CompareProduct No.DescriptionSDSPricing
401002
All Photos(1)

Margatoxin

Synonym(s): MgTx
Empirical Formula (Hill Notation): C178H286N52O50S7
CAS No.:
145808-47-5
Molecular Weight:
4178.95
CompareProduct No.DescriptionSDSPricing
M8278
All Photos(1)

Exendin-4

Empirical Formula (Hill Notation): C184H282N50O60S
CAS No.:
141758-74-9
Molecular Weight:
4186.57
CompareProduct No.DescriptionSDSPricing
E7144≥97%
All Photos(1)

Cecropin A

Empirical Formula (Hill Notation): C184H313N53O46
CAS No.:
80451-04-3
Molecular Weight:
4003.78
CompareProduct No.DescriptionSDSPricing
C6830≥97% (HPLC), powder
All Photos(1)

Synonym(s): Parathyroid Hormone Fragment 1-34 human, PTH 1-34, Parathormone (1-34)
Empirical Formula (Hill Notation): C181H291N55O51S2
CAS No.:
52232-67-4
Molecular Weight:
4117.72
All Photos(1)

Teriparatide for system suitability

Synonym(s): Parathyroid Hormone Fragment 1-34 human, PTH 1-34, Parathormone (1-34)
Empirical Formula (Hill Notation): C181H291N55O51S2
CAS No.:
52232-67-4
Molecular Weight:
4117.72
CompareProduct No.DescriptionSDSPricing
Y0001895European Pharmacopoeia (EP) Reference Standard
All Photos(1)

Exenatide

Synonym(s): Exendin-4
Empirical Formula (Hill Notation): C184H282N50O60S
CAS No.:
141758-74-9
Molecular Weight:
4186.57
CompareProduct No.DescriptionPricing
1269105United States Pharmacopeia (USP) Reference Standard
All Photos(1)

Parathyroid Hormone Fragment 1-34 bovine

Empirical Formula (Hill Notation): C183H288N54O50S2
CAS No.:
12583-68-5
Molecular Weight:
4108.71
CompareProduct No.DescriptionSDSPricing
P3671≥97% (HPLC), powder
All Photos(1)

Parathyroid Hormone 1-34, Human

Synonym(s): Parathyroid Hormone 1-34, Human
Empirical Formula (Hill Notation): C181H291N55O51S2
CAS No.:
52232-67-4
Molecular Weight:
4117.72
All Photos(1)

Synonym(s): NPY, hNPY, Neuropeptide Y, Human
Empirical Formula (Hill Notation): C189H285N55O57S
CAS No.:
90880-35-6
Molecular Weight:
4271.68
All Photos(1)

Adrenocorticotropic Hormone human

Synonym(s): Adrenocorticotropic hormone fragment 1-39, Corticotropin A
Empirical Formula (Hill Notation): C207H308N56O58S
CAS No.:
12279-41-3
Molecular Weight:
4541.07
CompareProduct No.DescriptionSDSPricing
A0423≥97% (HPLC)
All Photos(1)

Charybdotoxin

Empirical Formula (Hill Notation): C176H277N57O55S7
CAS No.:
95751-30-7
Molecular Weight:
4295.89
CompareProduct No.DescriptionSDSPricing
C7802≥90% (HPLC)
All Photos(1)

Glucagon-Like Peptide I human

Synonym(s): GLP-1, Preproglucagon 72-108
Empirical Formula (Hill Notation): C186H275N51O59
CAS No.:
87805-34-3
Molecular Weight:
4169.48
CompareProduct No.DescriptionSDSPricing
G3265≥97% (HPLC)
All Photos(1)

SNX-482 Recombinant

Synonym(s): GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD
Empirical Formula (Hill Notation): C192H274N52O60S7
CAS No.:
203460-30-4
Molecular Weight:
4495.00
CompareProduct No.DescriptionSDSPricing
SML1150≥98% (HPLC)
All Photos(1)

Parathyroid Hormone Fragment 1-34 human

Synonym(s): PTH 1-34, Parathormone (1-34)
Empirical Formula (Hill Notation): C181H291N55O51S2
CAS No.:
52232-67-4
Molecular Weight:
4117.72
CompareProduct No.DescriptionSDSPricing
P3796≥95% (HPLC), powder
All Photos(1)

Copeptin trifluoroacetate human

Synonym(s): H-Ala-Ser-Asp-Arg-Ser-Asn-Ala-Thr-Gln-Leu-Asp-Gly-Pro-Ala-Gly-Ala-Leu-Leu-Leu-Arg-Leu-Val-Gln-Leu-Ala-Gly-Ala-Pro-Glu-Pro-Phe-Glu-Pro-Ala-Gln-Pro-Asp-Ala-Tyr-OH trifluoroacetate
Empirical Formula (Hill Notation): C177H279N49O58 · xC2HF3O2
CAS No.:
78362-34-2
Molecular Weight:
4021.40 (free base basis)
CompareProduct No.DescriptionSDSPricing
C8749≥95% (HPLC)
All Photos(1)

Hypercalcemia of malignancy factor fragment 1-34 amide human

Synonym(s): Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-NH2, PTHrP (1-34) amide, Parathyroid hormone-related protein (1-34) Amide
Empirical Formula (Hill Notation): C180H288N58O47
CAS No.:
112955-31-4
Molecular Weight:
4016.57
CompareProduct No.DescriptionSDSPricing
H9148≥97% (HPLC)
Page 1 of 1