  • Home
  • Search Results
  • Snake venom-like waprin from the frog of Ceratophrys calcarata contains antimicrobial function.

Snake venom-like waprin from the frog of Ceratophrys calcarata contains antimicrobial function.

Gene (2012-12-04)
Daixi Liu, Yuwei Wang, Lin Wei, Huahu Ye, Huan Liu, Ling Wang, Rui Liu, Dongsheng Li, Ren Lai

A 255-bp cDNA encoding an 84-amino acid residue (aa) precursor protein containing 8 half-cysteines was cloned from the skin of the frog, Ceratophrys calcarata. By sequence comparison and signal peptide prediction, the precursor was predicted to release a 63-aa mature peptide with amino acid sequence, NVTPATKPTPSKPGYCRVMDELILCPDPPLSKDLCKNDSDCPGAQKCCYRTCIMQCLPPIFRE. The mature was named ceratoxin. Ceratoxin shares significant sequence similarity with the toxin family of waprins containing the whey acidic protein-type (WAP) four-disulfide core domain found in snake venoms. Antimicrobial and trypsin-inhibitory abilities of recombinant ceratoxin were tested. Recombinant ceratoxin showed strong antimicrobial activities against wide spectrum of microorganisms including Gram-negative and Gram-positive bacteria and fungi. It had no serine protease-inhibitory activity. The current results suggested that the snake venom-like waprin with antimicrobial activities in the frog skin plays a role in innate immunity.

Product Number
Product Description

Protease from Bacillus licheniformis, glycerol solution (50%)
α-Chymotrypsin from human pancreas, lyophilized powder
Protease from Bacillus licheniformis, Type VIII, lyophilized powder, 7-15 units/mg solid
α-Chymotrypsin−Agarose from bovine pancreas, lyophilized powder, 2,000-3,500 units/g agarose (One ml gel will yield 65-120 units)
α-Chymotrypsin from bovine pancreas, ≥40 units/mg protein, vial of 5 mg
α-Chymotrypsin from bovine pancreas, suitable for protein sequencing, salt-free, lyophilized powder
α-Chymotrypsin from bovine pancreas, Type I-S, essentially salt-free, lyophilized powder
α-Chymotrypsin from bovine pancreas, Type II, lyophilized powder, ≥40 units/mg protein
α-Chymotrypsin from bovine pancreas, (TLCK treated to inactivate residual tryspin activity), Type VII, essentially salt-free, lyophilized powder, ≥40 units/mg protein
Protease from Bacillus licheniformis, lyophilized powder, for use in Total Dietary Fiber Assay, TDF-100A
Protease from Bacillus licheniformis, ≥2.4 U/g
Proteinase, bacterial, Type XXIV, 7.0-14.0 units/mg solid, lyophilized powder