• USA Home
  • AMAB90988 - Monoclonal Anti-PDIA3 antibody produced in mouse

EMAIL THIS PAGE TO A FRIEND
AMAB90988 Sigma-Aldrich

Monoclonal Anti-PDIA3 antibody produced in mouse

Antibody Enhanced Validation

Prestige Antibodies® Powered by Atlas Antibodies, clone CL2444, purified immunoglobulin, buffered aqueous glycerol solution

Synonym: Monoclonal Anti-ERp57, Monoclonal Anti-ERp60, Monoclonal Anti-ERp61, Monoclonal Anti-GRP57, Monoclonal Anti-GRP58, Monoclonal Anti-HsT17083, Monoclonal Anti-P58, Monoclonal Anti-PI-PLC

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Antibodies for Cell Biology, Antibodies to Cell and Organelle Proteins, Antibodies to Cytoplasm,
product line   Prestige Antibodies® Powered by Atlas Antibodies
conjugate   unconjugated
clone   CL2444, monoclonal
biological source   mouse
application(s)   immunoblotting: 1 μg/mL
  immunofluorescence: 2-10 μg/mL
  immunohistochemistry: 1:5000- 1:10000
species reactivity   human
enhanced validation   orthogonal RNAseq
RNAi knockdown
Learn more about Antibody Enhanced Validation
form   buffered aqueous glycerol solution
shipped in   wet ice
storage temp.   −20°C
packaging   antibody small pack of 25 μL
antibody form   purified immunoglobulin
isotype   IgG1
Quality Level   100
antibody product type   primary antibodies
immunogen sequence   PTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDK
UniProt accession no.   P30101
Gene Information   human ... PDIA3(2923)

Description

General description

Monoclonal Anti-PDIA3 Prestige Antibodies® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and

PDIA3 (protein disulfide isomerase family A member 3) is also known as ERp57. It is present in the cytoplasm, nucleus and endoplasmic reticulum. ERp57 is a constituent of the multimeric spermatozoa-zona pellucida (ZP) receptor complex. This gene is located on human chromosome 15q15.

Immunogen

Protein disulfide isomerase family A, member 3

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Monoclonal Anti-PDIA3 antibody has been used in immunofluorescence.

Physical form

Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Biochem/physiol Actions

PDIA3 (protein disulfide isomerase family A member 3) participates in virus induced endoplasmic reticulum stress (ERS). It plays a major role in tumorigenesis. ERp57 is involved in the generation of major histocompatibility complex class I (MHC I) to impact the immunogenicity of tumor cells. It also regulates the thiol-disulphide status of proteins. PDIA3 is linked with several diseases like, cancer, prion disorders, Alzheimer′s disease and Parkinson′s diseases.

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.
• Validated for multiple commonly used applications such as IHC (Immunohistochemistry), IF (Immunofluorescence), and WB (Western Blot)

Linkage

Corresponding Antigen APREST86567.

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
WGK 1
Flash Point(F) 
Not applicable
Flash Point(C) 
Not applicable
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Prestige Antibody® Immunofluorescence Procedure

Prestige Antibodies® have been used for subcellular localization studies by immunocytochemistry (ICC) - immunofluorescence (IF) using the protocol described below. In addition to the primary antibodi...
Keywords: Immunocytochemistry, Immunofluorescence, Immunostaining, Sample preparations

Prestige Antibody® Immunohistochemistry Procedure

Prestige Antibodies® developed for immunohistochemistry based expression profiling are recommended to be used according to the standard IHC staining protocol described below.
Keywords: Buffers, Dehydration reaction, Gene expression, Hydration reaction, Immunohistochemistry, Immunostaining, Tissue microarrays

Prestige Antibody® Protein Immunoblotting Procedure

Prestige Antibodies® recommended for Western Blot are recommended to be used according to the standard WB protocol described below. Western blot standard protocol optimized for
Keywords: Catalytic combustion detector, Electrophoresis, Gene expression, Sample preparations, Western blot

Prestige Antigens™-Blocking Protocol

Prestige Antigens and the corresponding Prestige Antibodies are recommended to be used according to the standard blocking protocol described below.
Keywords: Immunocytochemistry, Immunohistochemistry, Immunostaining, Titrations, Western blot

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detection methods, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?