• USA Home
  • HPA010080 - Anti-COL6A3 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
HPA010080 Sigma-Aldrich

Anti-COL6A3 antibody produced in rabbit

Antibody Enhanced Validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-Collagen α-3(VI) chain precursor antibody produced in rabbit

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, CM-CY, CO-CP, Prestige Antibodies,
conjugate   unconjugated
clone   polyclonal
biological source   rabbit
application(s)   immunoblotting: 0.4 μg/mL
  immunohistochemistry: 1:50- 1:200
species reactivity   human
enhanced validation   orthogonal RNAseq
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
form   buffered aqueous glycerol solution
shipped in   wet ice
storage temp.   −20°C
antibody form   affinity isolated antibody
antibody product type   primary antibodies
grade   Prestige Antibodies® Powered by Atlas Antibodies
immunogen sequence   PRDLKIVVLMLTGEVPEQQLEEAQRVILQAKCKGYFFVVLGIGRKVNIKEVYTFASEPNDVFFKLVDKSTELNEEPLMRFGRLLPSFVSSENAFYLSPDIRKQCDWFQGDQPTKNLVKFGHKQVNVPNNVTSSPTSNPVTTTKPVT
UniProt accession no.   P12111
Gene Information   human ... COL6A3(1293)

Description

General description

COL6A3 (collagen type VI a3) is the a subunit of the fibrotic extracellular matrix protein called collagen. In muscles, it is one of the most abundant collagen expressed. This gene is localized to human chromosome 2q37.

Immunogen

Collagen α-3(VI) chain precursor recombinant protein epitope signature tag (PrEST)

Application

Anti-COL6A3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Biochem/physiol Actions

Studies in rodents show that the expression of COL6A3 (collagen type VI α3) is negatively regulated by leptin treatment. Its expression in human adipose tissue is also regulated by leptin, and its expression is decreased in obesity. In humans, its expression is linked with BMI (body mass index) and fat mass. The expression of COL6A3 is similar in patients with obesity and T2DM (type 2 diabtese mellitus), and it regulates adopose tissue macrophage chemotaxis and inflammation. Its expression is also linked with weight gain. The expression of this protein in adipocytes is linked with insulin resistance, which is thought to be dependent on PPAR (peroxisome proliferator-activated receptor) α-mediated adipocyte development.
Mutations in this gene are linked with both mild and server forms of Ullrich congenital muscular dystrophy. Mutations in this gene are also linked with Bethlem myopathy, which is an autosomal dominant disorder.

Linkage

Corresponding Antigen APREST86862.

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
1

Documents

Certificate of Analysis

???PDP_SDS_LOT_NUMBER_ERROR_MSG???

Certificate of Origin

???PDP_SDS_LOT_NUMBER_ERROR_MSG???
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Prestige Antibody® Immunofluorescence Procedure

Prestige Antibodies® have been used for subcellular localization studies by immunocytochemistry (ICC) - immunofluorescence (IF) using the protocol described below. In addition to the primary antibodi...
Keywords: Immunocytochemistry, Immunofluorescence, Immunostaining, Sample preparations

Prestige Antibody® Immunohistochemistry Procedure

Prestige Antibodies® developed for immunohistochemistry based expression profiling are recommended to be used according to the standard IHC staining protocol described below.
Keywords: Buffers, Dehydration reaction, Gene expression, Hydration reaction, Immunohistochemistry, Immunostaining, Tissue microarrays

Prestige Antibody® Protein Immunoblotting Procedure

Prestige Antibodies® recommended for Western Blot are recommended to be used according to the standard WB protocol described below. Western blot standard protocol optimized for
Keywords: Catalytic combustion detector, Electrophoresis, Gene expression, Sample preparations, Western blot

Prestige Antigens™-Blocking Protocol

Prestige Antigens and the corresponding Prestige Antibodies are recommended to be used according to the standard blocking protocol described below.
Keywords: Immunocytochemistry, Immunohistochemistry, Immunostaining, Titrations, Western blot

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?