• USA Home
  • SAB2102467 - Anti-TMEM35 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
SAB2102467 Sigma-Aldrich

Anti-TMEM35 antibody produced in rabbit

affinity isolated antibody

Synonym: Anti-FLJ14084, Anti-Transmembrane protein 35

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Primary Antibodies, TK-TM
conjugate   unconjugated
clone   polyclonal
biological source   rabbit
application(s)   western blot: suitable
species reactivity   rabbit, mouse, rat, human, guinea pig, horse, bovine
mol wt   18 kDa
form   buffered aqueous solution
shipped in   wet ice
storage temp.   −20°C
antibody form   affinity isolated antibody
antibody product type   primary antibodies
concentration   0.5 mg - 1 mg/mL
UniProt accession no.   Q53FP2
Gene Information   human ... TMEM35(59353)

Description

General description

Transmembrane protein 35 (TMEM35) is mostly expressed in hypothalamic-pituitary-adrenal (HPA) circuitry and limbic areas, including the hippocampus and amygdala of mice. TMEM35 sis also known as the unknown factor-1(TUF-1). Human TMEM35 consists of 167 amino acids and is located at human chromosome Xq22.

Immunogen

Synthetic peptide directed towards the C terminal region of human TMEM35

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biochem/physiol Actions

Transmembrane protein 35 (TMEM35) is a multi-pass membrane protein. Any alteration in Transmembrane protein 35 (TMEM35) causes long term memory loss as well as impairs behavioral functions. TMEM35 regulates cell cycle progression and thereby modulates osteosarcoma cell growth, migration and invasion, making it a potent drug development target for therapeutics. In zona glomerulosa, the neurite outgrowth after sodium depletion is regulated by TMEM35.

Sequence

Synthetic peptide located within the following region: VFGILLTCRLLIARKPEDRSSEKKPLPGNAEEQPSLYEKAPQGKVKVS

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
3

Documents

Certificate of Analysis

???PDP_SDS_LOT_NUMBER_ERROR_MSG???
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?