• USA Home
  • 05-23-2005 - Neuropeptide Y, Human - CAS 90880-35-6 - Calbiochem

EMAIL THIS PAGE TO A FRIEND
05-23-2005 Sigma-Aldrich

Neuropeptide Y, Human - CAS 90880-35-6 - Calbiochem

A potent vasoconstrictor.

Synonym: NPY, Human, YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH₂, Neuropeptide Y, Human - CAS 90880-35-6 - Calbiochem

  • CAS Number 90880-35-6

  • Empirical Formula (Hill Notation) C189H285N55O57S

  • Molecular Weight 4271.68

  •  MDL number MFCD00212432

Purchase

Properties

Quality Level   100
assay   ≥97% (HPLC)
form   lyophilized solid
mfr. no.   Calbiochem®
storage condition   OK to freeze
  desiccated
storage conditions   -20C
color   white to off-white
solubility   5% acetic acid: 1 mg/mL
shipped in   ambient

Description

General description

A potent vasoconstrictor. Reversibly inhibits Ca2+-activated K+ channels in vascular smooth muscle cells.

Biochem/physiol Actions

Cell permeable: no

Primary Target
A potent vasoconstrictor

Product does not compete with ATP.

Reversible: yes

Packaging

Yes

Warning

Toxicity: Harmful (C)

Sequence

H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH₂

Other Notes

Xiong, Z., and Cheung, D.W. 1994. Pflugers Arch. 429, 280.
Wahlestedt, C., et al. 1993. Science259, 528.
Leibowitz, S.F. 1992. NeuroReport3, 1023.

Safety & Documentation

Safety Information

Protocols & Articles
Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?