EMAIL THIS PAGE TO A FRIEND
06-847 Sigma-Aldrich

Anti-EGFR Antibody

Anti-EGFR Antibody detects level of EGFR & has been published & validated for use in IP & WB.

Synonym: Receptor tyrosine-protein kinase ErbB-1, avian erythroblastic leukemia viral (v-erb-b) oncogene homolog, cell growth inhibiting protein 40, cell proliferation-inducing protein 61, epidermal growth factor receptor, epidermal growth factor receptor (avian

  •  eCl@ss 32160702

Purchase

Properties

Related Categories Antibodies, Primary Antibodies More...
packaging   200 µg (06-847-25UG)
  25 μg (06-847-25UG)
application(s)   immunoprecipitation (IP): suitable
  western blot: suitable
biological source   rabbit
clone   polyclonal
isotype   IgG
shipped in   ambient
species reactivity   , rat, mouse, human, hamster
gene symbol   EGFR(1956)
trade name   Upstate
brand family   Upstate
format   Purified
molecular weight   180 kDa
concentration   Please refer to the Certificate of Analysis for the lot-specific concentration.
Species Reactivity Notes   Mouse and human. Reported to detect rat and hamster.
gene symbol   ERBB1
  ERBB
  mENA
Quality Assurance   Routinely evaluated by western blot on a mouse 3T3/A31 RIPA cell lysate.

Western Blot Analysis:
0.5-2 µg/mL of this lot detected the EGFR from a mouse 3T3/A31 RIPA cell lysate.

Description

Target description

180 kDa

Analysis Note

Control
A431 cell lysate, human cervical carcinoma.

Included Positive Antigen Control:
Catalog # 12-305, 3T3/A31 Cell Lysate. Add 2.5 µL of 2-mercaptoethanol/100 µL of lysate and boil for 5 minutes to reduce the preparation. Load 20 µg of reduced lysate per lane for minigels.

Application

Immunoprecipitation:
4 µg of a previous lot immunoprecipitated the EGFR from 500 µg of a 3T3/A31 RIPA cell lysate.
Immunohistochemistry (Paraffin) Analysis: A 1:500 Dilution of this antibody detected EGFR in human placenta tissue sections.

General description

The epidermal growth factor receptor (EGFR; ErbB-1; HER1 in humans) is the cell-surface receptor for members of the epidermal growth factor family (EGF-family) of extracellular protein ligands. The epidermal growth factor receptor is a member of the ErbB family of receptors, a subfamily of four closely related receptor tyrosine kinases: EGFR (ErbB-1), HER2/c-neu (ErbB-2), Her 3 (ErbB-3) and Her 4 (ErbB-4). Mutations affecting EGFR expression or activity could result in cancer. EGFR (epidermal growth factor receptor) exists on the cell surface and is activated by binding of its specific ligands, including epidermal growth factor and transforming growth factor α (TGFα). Upon activation by its growth factor ligands, EGFR undergoes a transition from an inactive monomeric form to an active homodimer. In addition to forming homodimers after ligand binding, EGFR may pair with another member of the ErbB receptor family, such as ErbB2/Her2/neu, to create an activated heterodimer. EGFR dimerization stimulates its intrinsic intracellular protein-tyrosine kinase activity. As a result, autophosphorylation of five tyrosine (Y) residues in the C-terminal domain of EGFR occurs.

Immunogen

Ovalbumin conjugated synthetic peptide (ETKPNGIFKGPTAENAEYLRVAPPSSEFIGA) corresponding to amino acids 1156-1186 of the processed mouse EGF receptor (EGFR) C-terminal domain (Accession number Q01279). The immunizing sequence shares 28/31 identity with the human EGF receptor sequence.

Other Notes

Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.

Specificity

Recognizes the EGFR, Mr 180 kDa.

Physical form

Format: Purified

Purified rabbit polyclonal IgG in buffer containing 0.1M Tris-Glycine, 0.15M NaCl, 0.05% Sodium Azide, pH 7.4. Store at 2-8°C.

Storage and Stability

Stable for 1 year at 2-8°C from date of receipt.

Handling Recommendations: Upon first thaw,
and prior to removing the cap, centrifuge the
vial and gently mix the solution.

Safety & Documentation

Safety Information

Safety Information for this product is unavailable at this time.

Documents

Certificate of Analysis

???PDP_SDS_LOT_NUMBER_ERROR_MSG???
Protocols & Articles
Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?