• USA Home
  • 208711 - Ca2+/Calmodulin Kinase II Inhibitor 281-309 - Calbiochem

EMAIL THIS PAGE TO A FRIEND
208711 Sigma-Aldrich

Ca2+/Calmodulin Kinase II Inhibitor 281-309 - Calbiochem

The Ca2+/Calmodulin Kinase II Inhibitor 281-309 controls the biological activity of Ca2+/Calmodulin Kinase II. This small molecule/inhibitor is primarily used for Phosphorylation & Dephosphorylation applications.

Synonym: Ca2+/Calmodulin Kinase II Inhibitor 281-309 - Calbiochem, CaM Kinase II Inhibitor 281-309, MHRQETVDCLKKFNARRKLKGAILTTMLA-OH

  • Empirical Formula (Hill Notation) C146H254N46O39S3

  • Molecular Weight 3374.06

Purchase

Properties

Related Categories A to C, Biochemicals and Reagents, Calmodulin dependent Protein Kinase (CaM-KK), Enzyme Inhibitors, Enzyme Inhibitors by Enzyme,
Quality Level   100
assay   ≥97% (HPLC)
form   lyophilized solid
potency   80 nM IC50
mfr. no.   Calbiochem®
storage condition   OK to freeze
  desiccated
storage conditions   -20C
solubility   water: 5 mg/mL
shipped in   ambient

Description

General description

A synthetic peptide containing the calmodulin binding site (290-309) and the autophosphorylation site (Thr286) of CaM kinase II. Can be phosphorylated at Thr286 by PKC. Useful as a calmodulin binding peptide. Inhibits CaM kinase II by blocking Ca2+/calmodulin activation (IC50 = 80 nM) and enzyme-active site (IC50 = 2 µM).

A synthetic peptide that contains the CaM-binding, inhibitory, and autophosphorylation domains of CaM kinase II. Can be phosphorylated at Thr286 by PKC. Useful as a calmodulin binding peptide. Inhibits CaM kinase II (IC50 = 80 nM) by blocking Ca2+/calmodulin activation and enzyme active site (IC50 = 2 µM).

Packaging

500 μg in Plastic ampoule

Biochem/physiol Actions

Cell permeable: no

Product does not compete with ATP.

Reversible: no

Packaging

Yes

Warning

Toxicity: Standard Handling (A)

Sequence

H-Met-His-Arg-Gln-Glu-Thr-Val-Asp-Cys-Leu-Lys-Lys-Phe-Asn-Ala-Arg-Arg-Lys-Leu-Lys-Gly-Ala-Ile-Leu-Thr-Thr-Met-Leu-Ala-OH

Other Notes

Waxham, M.N., et al. 1993. Biochemistry32, 2923.
Waxham, M.N., et al. 1993. Brain Res. 609, 1.
Fukunaga, K., et al. 1990. J. Neurochem.54, 103.
Colbran, R.J., et al. 1989. J. Biol. Chem. 264, 4800.
Colbran, R.J., et al. 1988. J. Biol. Chem.263, 18145.

Safety & Documentation

Safety Information

WGK Germany 
WGK 1
Flash Point(F) 
Not applicable
Flash Point(C) 
Not applicable
Protocols & Articles
Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?