EMAIL THIS PAGE TO A FRIEND
5093 Sigma-Aldrich

CD40 human

recombinant, expressed in E. coli, 0.5 mg protein/mL

Purchase

Properties

Related Categories Attachment Factors, Cell Culture, Cell Culture Media & Reagents, Drug Discovery, Reagents and Supplements More...
biological source   human
recombinant   expressed in E. coli
description   0.1 mg of recombinant human CD40 in 20 mM Tris-HCl buffer, containing NaCl, KCl, EDTA, L-arginine, DTT and glycerol.
sterility   Filtered sterilized solution
assay   ≥90% (SDS-PAGE)
form   liquid
packaging   pkg of 100 μg
concentration   0.5 mg protein/mL
suitability   suitable for cell culture
accession no.   NP_690593
storage temp.   −20°C

Description

Preparation Note

The full-length extracellular domain of the human CD40 gene (54-608 aa) was constructed with 29 N-terminal T7/HIS-tag and expressed in E. coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified.

Application

Coating a plate well (6 well plate) with this recombinant CD40 protein in neuronal cell specific medium at 1-10 μg/well (6 well plate) allows for 1) human neuronal cell / receptor interaction studies or 2) use as a culture matrix protein for human neuronal axon connection studies in vitro.

Use this procedure as a guideline to determine optimal coating conditions for the culture system of choice.
1. Thaw CD40 and dilute to desired concentration using serum-free medium or PBS. The final solution should be sufficiently dilute so the volume added covers the surface evenly (1-10 μg/well, 6 well plate).
2. Add appropriate amount of diluted material to culture surface.
3. Incubate at room temperature for approximately 1.5 hours.
4. Aspirate remaining material.
5. Rinse plates carefully with water and avoid scratching bottom surface of plates.
6. Plates are ready for use. They may also be stored at 2-8 °C damp or air dried if sterility is maintained.

Sequence

MASMTGGQQMGRGHHHHHHGNLYFQGGEFELEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTRSPGSAESPGGDPHHLRDPVCHPLGAGL

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
2

Documents

Certificate of Analysis


Cell Culture Guide

Milli-Q® Water Purification Solutions
Protocols & Articles

Related Content

Cell Culture Troubleshooting Guide

Cell culture has become one of the most fundamental techniques for modeling biological systems, and is of increasing importance in the biotechnology and pharmaceutical sectors as well as an essential...
Keywords: Antibiotics, Apoptosis, Cell attachment, Cell culture, Cryopreservation, Filtration, Growth factors, Pharmaceutical, Phase transitions

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?