EMAIL THIS PAGE TO A FRIEND
5123 Sigma-Aldrich

CD276 human

recombinant, expressed in E. coli, 0.5 mg protein/mL

Purchase

Properties

Related Categories Attachment Factors, Cell Culture, Reagents and Supplements More...
biological source   human
recombinant   expressed in E. coli
description   0.1 mg recombinant human CD276 in 20 mM Tris-HCl buffer, containing NaCl, KCl, EDTA, L-arginine, DTT and glycerol.
sterility   Filtered sterilized solution
assay   ≥90% (SDS-PAGE)
form   liquid
packaging   pkg of 100 μg
concentration   0.5 mg protein/mL
suitability   suitable for cell culture
accession no.   NP_001019907
storage temp.   −20°C

Description

Application

Coating a plate well (6 well plate) with this recombinant CD276 protein in T cell specific medium at 1-10 μg/well allows for use 1) for human T cell / receptor interaction study in vitro or 2) as a highly purified recombinant antigen as cancer biomarker for diagnosis application development.

Use this procedure as a guideline to determine optimal coating conditions for the culture system of choice.
1. Thaw CD276 and dilute to desired concentration using serum-free medium or PBS. The final solution should be sufficiently dilute so the volume added covers the surface evenly (1-10 μg/well, 6 well plate).
Note: Use 1 ml PBS per well in a 6-well plate.
2. Add 1 - 10 μg protein to each well and incubate at 2 to 10 °C overnight.
3. After incubation, aspirate remaining material.
4. Plates are ready for use. They may also be stored at 2-8 °C damp or air dried if sterility is maintained.

Sequence

MASMTGGQQMGRGHHHHHHGNLYFQGEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEA

Preparation Note

The full-length extracellular domain of the human CD276 gene (29 - 466 aa) was constructed with 29 N-terminal T7/HIS-tag and expressed in E. coli as inclusion bodies. The final product was refolded using a unique “temperature shift inclusion body refolding” technology and chromatographically purified.

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
2

Documents

Certificate of Analysis

???PDP_SDS_LOT_NUMBER_ERROR_MSG???

Cell Culture Guide

Milli-Q® Water Purification Solutions
Protocols & Articles

Related Content

Cell Culture Troubleshooting Guide

Cell culture has become one of the most fundamental techniques for modeling biological systems, and is of increasing importance in the biotechnology and pharmaceutical sectors as well as an essential...
Keywords: Antibiotics, Apoptosis, Cell attachment, Cell culture, Cryopreservation, Filtration, Growth factors, Pharmaceutical, Phase transitions

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?