• USA Home
  • HPA001328 - Anti-BRAF antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
HPA001328 Sigma-Aldrich

Anti-BRAF antibody produced in rabbit

Antibody Enhanced Validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-B-Raf proto-oncogene serine/threonine-protein kinase antibody produced in rabbit, Anti-p94 antibody produced in rabbit, Anti-v-Raf murine sarcoma viral oncogene homolog B1 antibody produced in rabbit

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Antibodies for Cell Biology, Antibodies for Kinase/Phosphatase Biology, B,
conjugate   unconjugated
clone   polyclonal
biological source   rabbit
application(s)   immunoblotting: 0.4 μg/mL
  immunohistochemistry: 1:50- 1:200
species reactivity   human, rat, mouse
enhanced validation   orthogonal RNAseq
Learn more about Antibody Enhanced Validation
form   buffered aqueous glycerol solution
shipped in   wet ice
storage temp.   −20°C
antibody form   affinity isolated antibody
antibody product type   primary antibodies
grade   Prestige Antibodies® Powered by Atlas Antibodies
immunogen sequence   PIPQEEASLAETALTSGSSPSAPASDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSS
Featured Industry   Research Pathology
UniProt accession no.   P15056
Gene Information   human ... BRAF(673)

Description

General description

B-Raf proto-oncogene serine/threonine-protein kinase (BRAF) is involved in the regulation of MAP kinase/ERKs signaling pathway, which affects cell division, differentiation, and secretion. Defective BRAF is associated with cardiofaciocutaneous syndrome, a disease characterized by heart defects, mental retardation and a distinctive facial appearance, and various cancers such as non-Hodgkin lymphoma, colorectal cancer, malignant melanoma, thyroid carcinoma, non-small cell lung carcinoma, and adenocarcinoma of lung.

Specificity

Rabbit polyclonal anti-BRAF antibody reacts with human B-Raf proto-oncogene serine/threonine-protein kinase.

Immunogen

B-Raf proto-oncogene, serine/threonine kinase

Application

Rabbit polyclonal anti-BRAF antibody is used to tag B-Raf proto-oncogene serine/threonine-protein kinase for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques such as ELISA, immunoblotting, and immunoprecipitation. It is used as a probe to determine the presence and roles of B-Raf proto-oncogene serine/threonine-protein kinase in MAP kinase/ERK signaling and the development and progression of several types of cancer.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Linkage

Corresponding Antigen APREST79898.

Safety & Documentation
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Prestige Antibody® Immunofluorescence Procedure

Prestige Antibodies® have been used for subcellular localization studies by immunocytochemistry (ICC) - immunofluorescence (IF) using the protocol described below. In addition to the primary antibodi...
Keywords: Immunocytochemistry, Immunofluorescence, Immunostaining, Sample preparations

Prestige Antibody® Immunohistochemistry Procedure

Prestige Antibodies® developed for immunohistochemistry based expression profiling are recommended to be used according to the standard IHC staining protocol described below.
Keywords: Buffers, Dehydration reaction, Gene expression, Hydration reaction, Immunohistochemistry, Immunostaining, Tissue microarrays

Prestige Antibody® Protein Immunoblotting Procedure

Prestige Antibodies® recommended for Western Blot are recommended to be used according to the standard WB protocol described below. Western blot standard protocol optimized for
Keywords: Catalytic combustion detector, Electrophoresis, Gene expression, Sample preparations, Western blot

Prestige Antigens™-Blocking Protocol

Prestige Antigens and the corresponding Prestige Antibodies are recommended to be used according to the standard blocking protocol described below.
Keywords: Immunocytochemistry, Immunohistochemistry, Immunostaining, Titrations, Western blot

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?