• USA Home
  • MSQC11 - SILuMAb Adalimumab Stable-Isotope Labeled Monoclonal Antibody

EMAIL THIS PAGE TO A FRIEND
MSQC11 Sigma-Aldrich

SILuMAb Adalimumab Stable-Isotope Labeled Monoclonal Antibody

Synonym: SIL Adalimumab

Purchase

Properties

Related Categories Antibody Characterization and Analysis, Biochemicals and Reagents, Mass Spectrometry, Molecular Biology, Peptide and Protein Standards for Mass Spectrometry Analysis,
recombinant   expressed in CHO cells
antibody product type   primary antibodies
assay   ≥90% (SDS-PAGE)
packaging   vial of 100 μg
shipped in   wet ice
storage temp.   −20°C

Description

Analysis Note

Quantitative
MRM settings provided (xls)

Immunogen

SILuMab Adalimumab Heavy Chain: EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSAITWNSGHIDYADSVEGR
FTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVSYLSTASSLDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNS
GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV
TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD
ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG

SILuMab Adalimumab Light Chain:
DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQRYNRAPYTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Preparation Note

Produced utilizing enriched media containing stable isotope labeled amino acids are 13C6, 15N4-labeled Arginine and 13C6, 15N2-labeled Lysine.
SILuMab Adalimumab is designed to be used as a internal standard for analysis of Adalimumab in human serum.

Reconstitution

Each vial of SILuMab Adalimumab contains the labeled antibody in a lyophilized form containing phosphate buffered saline.

SILuMab Adalimumab recovery is maximized when 0.1% formic acid is used for reconstitution of the lyophilized product.Reconstitution with other solvents may reduce recovery. Do not freeze after reconstitution.

•  Briefly centrifuge the vial at ~10,000 × g to collect the product at the bottom of the vial.
• Add 500 μL of ultrapure water containing 0.1% formic acid to the vial.
• Mix the contents by gently inverting the vial a minimum of 5 times.
• Allow the vial to stand at room temperature for at least 15 minutes and repeat mixing by inversion.

Application

Poster: Multiplex Quantification of Infliximab and Adalimumab in Human Serum by LC-MS/MS Using Full-Length Stable Isotope Labeled Internal Standards

General description

SILu MAb Adalimumab Stable-Isotope Labeled Monoclonal Antibody is a recombinant, stable isotope labeled, monoclonal antibody which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in CHO cells, SILuMAb Adalimumab is designed to be used as an internal standard for analysis of Adalimumab in human serum. Each vial of SILuMAb Adalimumab contains the labeled antibody lyophilized from a solution of phosphate buffered saline. Vial content was determined by measuring A280 and using an extinction coefficient (E0.1%) of 1.4.
SILu MAb Adalimumab is for research use only and is not intended for diagnostic or therapeutic use.

Legal Information

SILu is a trademark of Sigma-Aldrich Co. LLC

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.

Sequence

Adalimumab-Specific Peptide Sequences Liberated from SILuMAb Adalimumab by Tryptic Digest

Universal Peptide Sequence Location
GLEWVSAITWNSGHIDYADSVEGR Heavy chain
APYTFGQGTK Light chain
FSGSGSGTDFTLTISSLQPEDVATYYCQR Light chain

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport

Documents

Certificate of Analysis

Protocols & Articles

Articles

Development of Simple and Rapid Workflows for Quantitation of Infliximab and Adalimumab in Human Serum by LC-MS/MS

There is a growing demand for reliable LC-MS/MS assays to support quantitation of serum levels of infliximab and adalimumab monoclonal antibodies, as clinical responses differ between patients due to...
Kevin Ray, Yue Lu, and Pegah R. Jalili
MilliporeSigma, St. Louis, MO
Keywords: Centrifugation, Clinical, Digestions, High performance liquid chromatography, Liquid chromatography mass spectrometry, Mass spectrometry, Sample preparations

Multiplex Quantification of Infliximab and Adalimumab

Infliximab and Adalimumab monoclonal antibodies (mAbs) are used widely to treat rheumatoid arthritis, psoriatic arthritis and many autoimmune diseases by binding  to tumor necrosis factor-alpha (TNFα...
Pegah R. Jalili & Kevin Ray
MilliporeSigma, St. Louis, MO
Keywords: Clinical, Digestions, Diseases, Enzyme-linked immunosorbent assay, Glycosylations, High performance liquid chromatography, Liquid chromatography mass spectrometry, Mass spectrometry, Size-exclusion chromatography

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?