• USA Home
  • MSST0062 - SILuLite APOD, Apolipoprotein D human

EMAIL THIS PAGE TO A FRIEND
MSST0062 Sigma-Aldrich

SILuLite APOD, Apolipoprotein D human

recombinant, expressed in HEK 293 cells, MS Protein Standard, ≥95% (SDS-PAGE)

Synonym: Apo-D, ApoD

Purchase

Properties

Related Categories Biochemicals and Reagents, Proteins and Derivatives, SILuLite Protein Standards for Quantitative Mass Spectrometry More...
recombinant   expressed in HEK 293 cells
assay   ≥95% (SDS-PAGE)
form   lyophilized powder
UniProt accession no.   P05090
shipped in   ambient
storage temp.   −20°C
Gene Information   human ... APOD(347)

Description

Biochem/physiol Actions

Apolipoprotein D is a member of the Apolipoprotein family. Unlike other lipoproteins, which are mainly produced in the liver, apolipoprotein D is mainly produced in the brain and testes. It was found to be a putative biomarker of androgen receptor function in androgen insensitivity syndrome, the most common cause of disorders of sex development. Apolipoprotein D is associated with neurological disorders and nerve injury, especially related to myelin sheath. It was shown to be elevated in a rat model of stroke, and is elevated in patients with schizophrenia, bipolar disorder, and Alzheimer′s disease.

General description

SILuLite APOD is a recombinant human protein expressed in human 293 cells. It consists of 189 amino acids (including a C-terminal polyhistidine tag), with a calculated molecular mass of 21.69 kDa. SILuLite APOD is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

Physical form

Supplied as a lyophilized powder containing phosphate buffered saline.

Legal Information

SILu is a trademark of Sigma-Aldrich Co. LLC

Sequence

QAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLSDYKDDDDKGHHHHHHHHGGQ

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
Protocols & Articles
Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?