• USA Home
  • SAB1402417 - Monoclonal Anti-FZD7 antibody produced in mouse

EMAIL THIS PAGE TO A FRIEND
SAB1402417 Sigma

Monoclonal Anti-FZD7 antibody produced in mouse

clone 4D9, purified immunoglobulin, buffered aqueous solution

Synonym: FzE3

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, FP-FZ, Primary Antibodies
species reactivity   human
application(s)   ELISA: suitable
  capture ELISA: suitable
  immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  western blot: 1-5 μg/mL
clone   4D9, monoclonal
antibody form   purified immunoglobulin
form   buffered aqueous solution
isotype   IgG1κ
mol wt   antigen mol wt ~37 kDa
shipped in   dry ice
storage temp.   −20°C
Gene Information   human ... FZD7(8324)
biological source   mouse
conjugate   unconjugated
NCBI accession no.   NM_003507

Description

Immunogen

FZD7 (NP_003498.1, 155 a.a. ~ 253 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GAGEICVGQNTSDGSGGPGGGPTAYPTAPYLPDLPFTALPPGASDGRGRPAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRANGLMYFKEEERRFA

General description

Frizzled class receptor 7 (FZD7) is an oncogene involved in various malignancies. It is a receptor of Wingless (WNT) proteins. The protein possesses seven hydrophobic domains. The gene encoding FZD7 is localized on human chromosome 2q33.1.

Physical form

Solution in phosphate buffered saline, pH 7.4

Features and Benefits

Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Biochem/physiol Actions

Frizzled class receptor 7 (FZD7) modulates sensitivity to chemotherapeutic drugs. It functions in tumor initiation in melanoma cells. The protein acts as a mediator in canonical and non-canonical Wnt signaling pathways.

Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
WGK Germany  3
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Search & filter by validated application (ie, WB, IF/ICC, IHC, ELISA, etc,) host species, clonality (monoclonal, polyclonal and recombinant) and more. Learn from technical information, product highli...
Keywords: Amplification, Buffers, Enzyme-linked immunosorbent assay, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Phosphorylations, Purification, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?