• USA Home
  • WH0001027M1 - Monoclonal Anti-CDKN1B antibody produced in mouse

EMAIL THIS PAGE TO A FRIEND
WH0001027M1 Sigma

Monoclonal Anti-CDKN1B antibody produced in mouse

clone 4B4-E6, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-cyclin-dependent kinase inhibitor 1B (p27, Kip1), Anti-CDKN4, Anti-KIP1, Anti-P27KIP1

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Antibodies for Cell Biology, Antibodies for Cell Cycle, Antibodies for Kinase/Phosphatase Biology,
species reactivity   human
application(s)   ELISA: suitable
  capture ELISA: suitable
  immunofluorescence: suitable
  immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  proximity ligation assay: suitable
  western blot: 1-5 μg/mL
clone   4B4-E6, monoclonal
antibody form   purified immunoglobulin
form   buffered aqueous solution
isotype   IgG1κ
shipped in   dry ice
storage temp.   −20°C
Gene Information   human ... CDKN1B(1027)
biological source   mouse
conjugate   unconjugated
GenBank® accession no.   BC001971

Description

Immunogen

CDKN1B (AAH01971, 1 a.a. ~ 198 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDGSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATGDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT

General description

This gene encodes a cyclin-dependent kinase inhibitor, which shares a limited similarity with CDK inhibitor CDKN1A/p21. The encoded protein binds to and prevents the activation of cyclin E-CDK2 or cyclin D-CDK4 complexes, and thus controls the cell cycle progression at G1. The degradation of this protein, which is triggered by its CDK dependent phosphorylation and subsequent ubiquitination by SCF complexes, is required for the cellular transition from quiescence to the proliferative state. (provided by RefSeq)

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Features and Benefits

Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Price and Availability


Antibody Explorer

Explore with Confidence
Safety & Documentation
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Related Content

Antibody Explorer | Buy Primary & Secondary Antibodies

Monoclonal and polyclonal primary antibodies are focused on cell biology, neurobiology and molecular biology. Secondary antibodies targeting multiple host’s IgG are conjugated to alkaline phosphatase...
Keywords: Amplification, Buffers, Cell biology, Enzyme-linked immunosorbent assay, Immunofluorescence, Immunohistochemistry, Inflammation, Molecular biology, Phosphorylations, Purification, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?