• USA Home
  • AMAB90905 - Monoclonal Anti-CD40 antibody produced in mouse

EMAIL THIS PAGE TO A FRIEND
AMAB90905 Sigma-Aldrich

Monoclonal Anti-CD40 antibody produced in mouse

Antibody Enhanced Validation

Prestige Antibodies® Powered by Atlas Antibodies, clone CL1673, purified immunoglobulin, buffered aqueous glycerol solution

Synonym: Anti-Bp50, Anti-TNFRSF5, Anti-p50

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, CD0-CDC, Primary Antibodies
conjugate   unconjugated
clone   CL1673, monoclonal
biological source   mouse
application(s)   immunoblotting: 1 μg/mL
  immunohistochemistry: 1:2500-1:5000
species reactivity   human
enhanced validation   orthogonal RNAseq
Learn more about Antibody Enhanced Validation
form   buffered aqueous glycerol solution
shipped in   wet ice
storage temp.   −20°C
antibody form   purified immunoglobulin
isotype   IgG1
antibody product type   primary antibodies
grade   Prestige Antibodies® Powered by Atlas Antibodies
immunogen sequence   KQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCE
UniProt accession no.   P25942

Description

General description

Cluster of differentiation 40 (CD40) is a type I transmembrane glycoprotein. It has a molecular weight of about 40-50kDa and is made of 277 amino acids. The CD40 gene is mapped to human chromosome 20q11-13 and has nine exons.

Immunogen

CD40 molecule, TNF receptor superfamily member 5

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Monoclonal Anti-CD40 Prestige Antibodies® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using protein array and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/ Prestige.

Physical form

Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Biochem/physiol Actions

Cluster of differentiation 40 (CD40) plays a major role in cellular and humoral immunity. It initiates inflammatory response to induce the progression of atherosclerosis. The CD40 pathway participates in the growth and pathogenesis of autoimmune diseases like rheumatoid arthritis (RA).

Linkage

Corresponding Antigen APREST78053.

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
1

Documents

Certificate of Analysis

???PDP_SDS_LOT_NUMBER_ERROR_MSG???
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Prestige Antigens™-Blocking Protocol

Prestige Antigens and the corresponding Prestige Antibodies are recommended to be used according to the standard blocking protocol described below.
Keywords: Immunocytochemistry, Immunohistochemistry, Immunostaining, Titrations, Western blot

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?