• USA Home
  • APREST70833 - PrEST Antigen TGFB1I1

EMAIL THIS PAGE TO A FRIEND
APREST70833 Sigma-Aldrich

PrEST Antigen TGFB1I1

Prestige Antigens Powered by Atlas Antibodies, buffered aqueous solution

Synonym: ARA55, Hic-5, TSC-5

Purchase

Properties

recombinant   expressed in E. coli
assay   >80% (SDS-PAGE)
form   buffered aqueous solution
mol wt   predicted mol wt 27 kDa
purified by   immobilized metal affinity chromatography (IMAC)
concentration   ≥0.5 mg/mL
immunogen sequence   AGQVVTALGRAWHPEHFVCGGCSTALGGSSFFEKDGAPFCPECYFERFSPRCGFCNQPIRHKMVTALGTHWHPEHFCCVSCGEPF
Ensembl | human accession no.   ENSG00000140682
UniProt accession no.   O43294
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... TGFB1I1(7041)

Description

General description

Recombinant protein fragment of Human TGFB1I1 with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.

Application

Suitable as a blocking agent using corresponding antibodies.

Linkage

Corresponding Antibody HPA006376.

Physical form

Solution in 1 M urea-PBS, pH 7.4

Preparation Note

The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.

Legal Information

Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
2

Documents

Certificate of Analysis (COA)

Please Enter a Lot Number
Protocols & Articles
Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?