• USA Home
  • APREST89541 - PrEST Antigen GPX4

EMAIL THIS PAGE TO A FRIEND
APREST89541 Sigma-Aldrich

PrEST Antigen GPX4

Prestige Antigens Powered by Atlas Antibodies, buffered aqueous solution

Synonym: MCSP, PHGPx

Purchase

Properties

Related Categories Antibodies, Prestige Antigens, Prestige Antigens G - H More...
recombinant   expressed in E. coli
assay   >80% (SDS-PAGE)
form   buffered aqueous solution
mol wt   predicted mol wt 26 kDa
purified by   immobilized metal affinity chromatography (IMAC)
concentration   ≥0.5 mg/mL
immunogen sequence   NVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHY
Ensembl | human accession no.   ENSG00000167468
UniProt accession no.   P36969
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... GPX4(2879)

Description

General description

Recombinant protein fragment of Human GPX4 with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.    

Application

Blocking agent and positive assay control using corresponding antibodies.

Linkage

Corresponding Antibody HPA047224.

Physical form

Solution in phosphate-buffered saline and 1M Urea, pH 7.4

Preparation Note

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport

Documents

Certificate of Analysis

???PDP_SDS_LOT_NUMBER_ERROR_MSG???
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?