• USA Home
  • AV30104 - Anti-RBM10 (AB2) antibody produced in rabbit

AV30104 Sigma-Aldrich

Anti-RBM10 (AB2) antibody produced in rabbit

IgG fraction of antiserum

Synonym: Anti-RNA binding motif protein 10



species reactivity   horse, rat, mouse, rabbit, bovine, guinea pig, human
application(s)   immunohistochemistry: suitable
  western blot: suitable
clone   polyclonal
concentration   0.5 mg - 1 mg/mL
antibody form   IgG fraction of antiserum
form   buffered aqueous solution
mol wt   mol wt 104 kDa
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... RBM10(8241)
biological source   rabbit
antibody product type   primary antibodies
conjugate   unconjugated
NCBI accession no.   NP_005667
UniProt accession no.   P98175



Synthetic peptide directed towards the N terminal region of human RBM10

General description

The RNA Binding Motif 10 (RBM10) is similar to RBM5 and functions as a modulator of apoptosis. RBM10 can also act as an RNA binding protein and regulate the co-transcriptional modification of pre-mRNA.
Rabbit Anti-RBM10 antibody recognizes canine, mouse, rat, and human RBM10.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.


Rabbit Anti-RBM10 antibody can be used for western blot (1.4μg/ml) and immunohistochemistry (4-8μg/ml, using paraffin-embedded tissues) applications.


Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biochem/physiol Actions

RBM10 contains RNA recognition motif found in a variety of RNA binding proteins, including various hnRNP proteins, proteins implicated in regulation of alternative splicing, and protein components of snRNPs. In vitro studies showed that the rat homolog bound to RNA homopolymers, with a preference for G and U polyribonucleotides. This gene is part of a gene cluster on chromosome Xp11.23, and its 3′ end lies within 20 kb upstream of UBE1.


Synthetic peptide located within the following region: QRRRRRRHRHSPTGPPGFPRDGDYRDQDYRTEQGEEEEEEEDEEEEEKAS

Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
WGK Germany  3
Protocols & Articles


Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy


Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary and Secondary Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay needs. Use the Antibody...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Therapeutic uses, Western blot

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?