• USA Home
  • AV32364 - Anti-TBX19 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
AV32364 Sigma-Aldrich

Anti-TBX19 antibody produced in rabbit

affinity isolated antibody

Synonym: Anti-FLJ26302, Anti-FLJ34543, Anti-T-box 19, Anti-TBS19, Anti-TPIT, Anti-dJ747L4.1

  •  NACRES NA.41

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Antibodies for Epigenetics and Nuclear Signaling, Antibodies to Transcription Factors, Primary Antibodies,
conjugate   unconjugated
clone   polyclonal
biological source   rabbit
application(s)   western blot: suitable
species reactivity   human
mol wt   48 kDa
form   buffered aqueous solution
shipped in   wet ice
storage temp.   −20°C
antibody form   affinity isolated antibody
Quality Level   100
antibody product type   primary antibodies
concentration   0.5 mg - 1 mg/mL
NCBI accession no.   NP_005140
UniProt accession no.   O60806
Gene Information   human ... TBX19(9095)

Description

General description

Rabbit polyclonal anti-TBX19 antibody reacts with canine, human, mouse, and bovine T-box 19 transcription factors.

T-box 19 (TBX19) is a transcription factor that binds the DNA sequence called T-box found in the promoters of certain genes. T-box genes encode transcription factors that regulate developmental processes. TBX19 is the human ortholog of the mouse Tpit gene that activates pro-opiomelanocortin (POMC) expression by corticotrophs and melaotrophs.

Immunogen

Synthetic peptide directed towards the middle region of human TBX19

Application

Rabbit Anti-TBX19 antibody can be used for western blotting applications at a concentration of 0.5μg/ml.

Rabbit polyclonal anti-TBX19 antibody is used to tag T-box 19 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of T-box 19 in pituitary restricted expression of pro-opiomelanocortin (POMC).

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biochem/physiol Actions

TBX19 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is the human ortholog of mouse Tbx19/Tpit gene. Studies in mouse show that Tpit protein is present only in the two pituitary pro-opiomelanocortin (POMC)-expressing lineages, the corticotrophs and melanotrophs. Mutations in the human ortholog were found in patients with isolated deficiency of pituitary POMC-derived ACTH, suggesting an essential role for this gene in differentiation of the pituitary POMC lineage.This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. Mutations in this gene were found in patients with isolated deficiency of pituitary POMC-derived ACTH, suggesting an essential role for this gene in differentiation of the pituitary POMC lineage. ACTH deficiency is characterized by adrenal insufficiency symptoms such as weight loss, lack of appetite (anorexia), weakness, nausea, vomiting, and low blood pressure. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Sequence

Synthetic peptide located within the following region: IKYNPFAKAFLDAKERNHLRDVPEAISESQHVTYSHLGGWIFSNPDGVCT

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
WGK 3
Flash Point(F) 
Not applicable
Flash Point(C) 
Not applicable

Documents

Certificate of Analysis (COA)

Please Enter a Lot Number
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detection methods, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?